From e1762c552391da838afb0ee6cfd9bb7d2a6ff52b Mon Sep 17 00:00:00 2001 From: "dependabot[bot]" <49699333+dependabot[bot]@users.noreply.github.com> Date: Mon, 21 Apr 2025 14:16:25 +0000 Subject: [PATCH] Bump the go-dependencies group across 1 directory with 25 updates Bumps the go-dependencies group with 23 updates in the / directory: | Package | From | To | | --- | --- | --- | | [github.com/go-openapi/swag](https://github.com/go-openapi/swag) | `0.23.0` | `0.23.1` | | [github.com/golang-migrate/migrate/v4](https://github.com/golang-migrate/migrate) | `4.18.1` | `4.18.2` | | [github.com/golang/snappy](https://github.com/golang/snappy) | `0.0.4` | `1.0.0` | | [github.com/hashicorp/consul/api](https://github.com/hashicorp/consul) | `1.31.0` | `1.32.0` | | [github.com/klauspost/compress](https://github.com/klauspost/compress) | `1.17.11` | `1.18.0` | | [github.com/minio/minio-go/v7](https://github.com/minio/minio-go) | `7.0.82` | `7.0.90` | | [github.com/opentracing-contrib/go-grpc](https://github.com/opentracing-contrib/go-grpc) | `0.1.0` | `0.1.2` | | [github.com/prometheus/client_golang](https://github.com/prometheus/client_golang) | `1.21.1` | `1.22.0` | | [github.com/prometheus/client_model](https://github.com/prometheus/client_model) | `0.6.1` | `0.6.2` | | [github.com/prometheus/common](https://github.com/prometheus/common) | `0.62.0` | `0.63.0` | | [github.com/spf13/afero](https://github.com/spf13/afero) | `1.11.0` | `1.14.0` | | [go.etcd.io/etcd/api/v3](https://github.com/etcd-io/etcd) | `3.5.17` | `3.5.21` | | [go.etcd.io/etcd/client/pkg/v3](https://github.com/etcd-io/etcd) | `3.5.17` | `3.5.21` | | [go.etcd.io/etcd/client/v3](https://github.com/etcd-io/etcd) | `3.5.17` | `3.5.21` | | [go.opentelemetry.io/contrib/propagators/aws](https://github.com/open-telemetry/opentelemetry-go-contrib) | `1.33.0` | `1.35.0` | | [go.opentelemetry.io/otel/bridge/opentracing](https://github.com/open-telemetry/opentelemetry-go) | `1.33.0` | `1.35.0` | | [go.opentelemetry.io/otel/exporters/otlp/otlptrace](https://github.com/open-telemetry/opentelemetry-go) | `1.34.0` | `1.35.0` | | [go.opentelemetry.io/otel/exporters/otlp/otlptrace/otlptracegrpc](https://github.com/open-telemetry/opentelemetry-go) | `1.34.0` | `1.35.0` | | [golang.org/x/sync](https://github.com/golang/sync) | `0.12.0` | `0.13.0` | | [golang.org/x/time](https://github.com/golang/time) | `0.9.0` | `0.11.0` | | [github.com/prometheus/procfs](https://github.com/prometheus/procfs) | `0.15.1` | `0.16.0` | | [github.com/tjhop/slog-gokit](https://github.com/tjhop/slog-gokit) | `0.1.3` | `0.1.4` | | [go.opentelemetry.io/collector/pdata](https://github.com/open-telemetry/opentelemetry-collector) | `1.24.0` | `1.30.0` | Updates `github.com/go-openapi/swag` from 0.23.0 to 0.23.1 - [Commits](https://github.com/go-openapi/swag/compare/v0.23.0...v0.23.1) Updates `github.com/golang-migrate/migrate/v4` from 4.18.1 to 4.18.2 - [Release notes](https://github.com/golang-migrate/migrate/releases) - [Changelog](https://github.com/golang-migrate/migrate/blob/master/.goreleaser.yml) - [Commits](https://github.com/golang-migrate/migrate/compare/v4.18.1...v4.18.2) Updates `github.com/golang/snappy` from 0.0.4 to 1.0.0 - [Release notes](https://github.com/golang/snappy/releases) - [Commits](https://github.com/golang/snappy/compare/v0.0.4...v1.0.0) Updates `github.com/hashicorp/consul/api` from 1.31.0 to 1.32.0 - [Release notes](https://github.com/hashicorp/consul/releases) - [Changelog](https://github.com/hashicorp/consul/blob/main/CHANGELOG.md) - [Commits](https://github.com/hashicorp/consul/compare/api/v1.31.0...api/v1.32.0) Updates `github.com/klauspost/compress` from 1.17.11 to 1.18.0 - [Release notes](https://github.com/klauspost/compress/releases) - [Changelog](https://github.com/klauspost/compress/blob/master/.goreleaser.yml) - [Commits](https://github.com/klauspost/compress/compare/v1.17.11...v1.18.0) Updates `github.com/minio/minio-go/v7` from 7.0.82 to 7.0.90 - [Release notes](https://github.com/minio/minio-go/releases) - [Commits](https://github.com/minio/minio-go/compare/v7.0.82...v7.0.90) Updates `github.com/opentracing-contrib/go-grpc` from 0.1.0 to 0.1.2 - [Release notes](https://github.com/opentracing-contrib/go-grpc/releases) - [Commits](https://github.com/opentracing-contrib/go-grpc/compare/v0.1.0...v0.1.2) Updates `github.com/prometheus/client_golang` from 1.21.1 to 1.22.0 - [Release notes](https://github.com/prometheus/client_golang/releases) - [Changelog](https://github.com/prometheus/client_golang/blob/main/CHANGELOG.md) - [Commits](https://github.com/prometheus/client_golang/compare/v1.21.1...v1.22.0) Updates `github.com/prometheus/client_model` from 0.6.1 to 0.6.2 - [Release notes](https://github.com/prometheus/client_model/releases) - [Commits](https://github.com/prometheus/client_model/compare/v0.6.1...v0.6.2) Updates `github.com/prometheus/common` from 0.62.0 to 0.63.0 - [Release notes](https://github.com/prometheus/common/releases) - [Changelog](https://github.com/prometheus/common/blob/main/RELEASE.md) - [Commits](https://github.com/prometheus/common/compare/v0.62.0...v0.63.0) Updates `github.com/spf13/afero` from 1.11.0 to 1.14.0 - [Release notes](https://github.com/spf13/afero/releases) - [Commits](https://github.com/spf13/afero/compare/v1.11.0...v1.14.0) Updates `go.etcd.io/etcd/api/v3` from 3.5.17 to 3.5.21 - [Release notes](https://github.com/etcd-io/etcd/releases) - [Commits](https://github.com/etcd-io/etcd/compare/v3.5.17...v3.5.21) Updates `go.etcd.io/etcd/client/pkg/v3` from 3.5.17 to 3.5.21 - [Release notes](https://github.com/etcd-io/etcd/releases) - [Commits](https://github.com/etcd-io/etcd/compare/v3.5.17...v3.5.21) Updates `go.etcd.io/etcd/client/v3` from 3.5.17 to 3.5.21 - [Release notes](https://github.com/etcd-io/etcd/releases) - [Commits](https://github.com/etcd-io/etcd/compare/v3.5.17...v3.5.21) Updates `go.opentelemetry.io/contrib/propagators/aws` from 1.33.0 to 1.35.0 - [Release notes](https://github.com/open-telemetry/opentelemetry-go-contrib/releases) - [Changelog](https://github.com/open-telemetry/opentelemetry-go-contrib/blob/main/CHANGELOG.md) - [Commits](https://github.com/open-telemetry/opentelemetry-go-contrib/compare/v1.33.0...v1.35.0) Updates `go.opentelemetry.io/otel/bridge/opentracing` from 1.33.0 to 1.35.0 - [Release notes](https://github.com/open-telemetry/opentelemetry-go/releases) - [Changelog](https://github.com/open-telemetry/opentelemetry-go/blob/main/CHANGELOG.md) - [Commits](https://github.com/open-telemetry/opentelemetry-go/compare/v1.33.0...v1.35.0) Updates `go.opentelemetry.io/otel/exporters/otlp/otlptrace` from 1.34.0 to 1.35.0 - [Release notes](https://github.com/open-telemetry/opentelemetry-go/releases) - [Changelog](https://github.com/open-telemetry/opentelemetry-go/blob/main/CHANGELOG.md) - [Commits](https://github.com/open-telemetry/opentelemetry-go/compare/v1.34.0...v1.35.0) Updates `go.opentelemetry.io/otel/exporters/otlp/otlptrace/otlptracegrpc` from 1.34.0 to 1.35.0 - [Release notes](https://github.com/open-telemetry/opentelemetry-go/releases) - [Changelog](https://github.com/open-telemetry/opentelemetry-go/blob/main/CHANGELOG.md) - [Commits](https://github.com/open-telemetry/opentelemetry-go/compare/v1.34.0...v1.35.0) Updates `golang.org/x/net` from 0.37.0 to 0.38.0 - [Commits](https://github.com/golang/net/compare/v0.37.0...v0.38.0) Updates `golang.org/x/sync` from 0.12.0 to 0.13.0 - [Commits](https://github.com/golang/sync/compare/v0.12.0...v0.13.0) Updates `golang.org/x/time` from 0.9.0 to 0.11.0 - [Commits](https://github.com/golang/time/compare/v0.9.0...v0.11.0) Updates `github.com/prometheus/procfs` from 0.15.1 to 0.16.0 - [Release notes](https://github.com/prometheus/procfs/releases) - [Commits](https://github.com/prometheus/procfs/compare/v0.15.1...v0.16.0) Updates `github.com/tjhop/slog-gokit` from 0.1.3 to 0.1.4 - [Release notes](https://github.com/tjhop/slog-gokit/releases) - [Changelog](https://github.com/tjhop/slog-gokit/blob/main/.goreleaser.yaml) - [Commits](https://github.com/tjhop/slog-gokit/compare/v0.1.3...v0.1.4) Updates `go.opentelemetry.io/collector/pdata` from 1.24.0 to 1.30.0 - [Release notes](https://github.com/open-telemetry/opentelemetry-collector/releases) - [Changelog](https://github.com/open-telemetry/opentelemetry-collector/blob/main/CHANGELOG-API.md) - [Commits](https://github.com/open-telemetry/opentelemetry-collector/compare/pdata/v1.24.0...pdata/v1.30.0) Updates `google.golang.org/protobuf` from 1.36.4 to 1.36.6 --- updated-dependencies: - dependency-name: github.com/go-openapi/swag dependency-version: 0.23.1 dependency-type: direct:production update-type: version-update:semver-patch dependency-group: go-dependencies - dependency-name: github.com/golang-migrate/migrate/v4 dependency-version: 4.18.2 dependency-type: direct:production update-type: version-update:semver-patch dependency-group: go-dependencies - dependency-name: github.com/golang/snappy dependency-version: 1.0.0 dependency-type: direct:production update-type: version-update:semver-major dependency-group: go-dependencies - dependency-name: github.com/hashicorp/consul/api dependency-version: 1.32.0 dependency-type: direct:production update-type: version-update:semver-minor dependency-group: go-dependencies - dependency-name: github.com/klauspost/compress dependency-version: 1.18.0 dependency-type: direct:production update-type: version-update:semver-minor dependency-group: go-dependencies - dependency-name: github.com/minio/minio-go/v7 dependency-version: 7.0.90 dependency-type: direct:production update-type: version-update:semver-patch dependency-group: go-dependencies - dependency-name: github.com/opentracing-contrib/go-grpc dependency-version: 0.1.2 dependency-type: direct:production update-type: version-update:semver-patch dependency-group: go-dependencies - dependency-name: github.com/prometheus/client_golang dependency-version: 1.22.0 dependency-type: direct:production update-type: version-update:semver-minor dependency-group: go-dependencies - dependency-name: github.com/prometheus/client_model dependency-version: 0.6.2 dependency-type: direct:production update-type: version-update:semver-patch dependency-group: go-dependencies - dependency-name: github.com/prometheus/common dependency-version: 0.63.0 dependency-type: direct:production update-type: version-update:semver-minor dependency-group: go-dependencies - dependency-name: github.com/spf13/afero dependency-version: 1.14.0 dependency-type: direct:production update-type: version-update:semver-minor dependency-group: go-dependencies - dependency-name: go.etcd.io/etcd/api/v3 dependency-version: 3.5.21 dependency-type: direct:production update-type: version-update:semver-patch dependency-group: go-dependencies - dependency-name: go.etcd.io/etcd/client/pkg/v3 dependency-version: 3.5.21 dependency-type: direct:production update-type: version-update:semver-patch dependency-group: go-dependencies - dependency-name: go.etcd.io/etcd/client/v3 dependency-version: 3.5.21 dependency-type: direct:production update-type: version-update:semver-patch dependency-group: go-dependencies - dependency-name: go.opentelemetry.io/contrib/propagators/aws dependency-version: 1.35.0 dependency-type: direct:production update-type: version-update:semver-minor dependency-group: go-dependencies - dependency-name: go.opentelemetry.io/otel/bridge/opentracing dependency-version: 1.35.0 dependency-type: direct:production update-type: version-update:semver-minor dependency-group: go-dependencies - dependency-name: go.opentelemetry.io/otel/exporters/otlp/otlptrace dependency-version: 1.35.0 dependency-type: direct:production update-type: version-update:semver-minor dependency-group: go-dependencies - dependency-name: go.opentelemetry.io/otel/exporters/otlp/otlptrace/otlptracegrpc dependency-version: 1.35.0 dependency-type: direct:production update-type: version-update:semver-minor dependency-group: go-dependencies - dependency-name: golang.org/x/net dependency-version: 0.38.0 dependency-type: direct:production update-type: version-update:semver-minor dependency-group: go-dependencies - dependency-name: golang.org/x/sync dependency-version: 0.13.0 dependency-type: direct:production update-type: version-update:semver-minor dependency-group: go-dependencies - dependency-name: golang.org/x/time dependency-version: 0.11.0 dependency-type: direct:production update-type: version-update:semver-minor dependency-group: go-dependencies - dependency-name: github.com/prometheus/procfs dependency-version: 0.16.0 dependency-type: direct:production update-type: version-update:semver-minor dependency-group: go-dependencies - dependency-name: github.com/tjhop/slog-gokit dependency-version: 0.1.4 dependency-type: direct:production update-type: version-update:semver-patch dependency-group: go-dependencies - dependency-name: go.opentelemetry.io/collector/pdata dependency-version: 1.30.0 dependency-type: direct:production update-type: version-update:semver-minor dependency-group: go-dependencies - dependency-name: google.golang.org/protobuf dependency-version: 1.36.6 dependency-type: direct:production update-type: version-update:semver-patch dependency-group: go-dependencies ... Signed-off-by: dependabot[bot] --- go.mod | 75 +- go.sum | 152 +- .../github.com/go-openapi/swag/.golangci.yml | 34 +- vendor/github.com/go-openapi/swag/errors.go | 15 + vendor/github.com/go-openapi/swag/json.go | 3 +- vendor/github.com/go-openapi/swag/loading.go | 2 +- vendor/github.com/go-openapi/swag/yaml.go | 32 +- .../goccy/go-json/internal/decoder/compile.go | 18 +- .../internal/decoder/compile_norace.go | 1 + .../go-json/internal/decoder/compile_race.go | 1 + .../go-json/internal/encoder/compiler.go | 16 +- .../internal/encoder/compiler_norace.go | 1 + .../go-json/internal/encoder/compiler_race.go | 1 + .../goccy/go-json/internal/encoder/encoder.go | 5 + .../goccy/go-json/internal/runtime/type.go | 108 +- .../golang-migrate/migrate/v4/migrate.go | 4 +- vendor/github.com/golang/snappy/README | 7 +- .../github.com/golang/snappy/encode_arm64.s | 4 +- .../grpc-gateway/v2/runtime/handler.go | 2 +- .../grpc-gateway/v2/runtime/mux.go | 8 + .../grpc-gateway/v2/runtime/query.go | 16 +- .../consul/api/config_entry_jwt_provider.go | 6 + .../github.com/hashicorp/consul/api/health.go | 2 + .../github.com/klauspost/compress/README.md | 140 +- .../klauspost/compress/flate/fast_encoder.go | 63 +- .../compress/flate/huffman_bit_writer.go | 19 +- .../klauspost/compress/flate/level1.go | 48 +- .../klauspost/compress/flate/level2.go | 2 +- .../klauspost/compress/flate/level3.go | 2 +- .../klauspost/compress/flate/level4.go | 10 +- .../klauspost/compress/flate/level5.go | 40 +- .../klauspost/compress/flate/level6.go | 32 +- .../compress/flate/matchlen_amd64.go | 16 - .../klauspost/compress/flate/matchlen_amd64.s | 66 - .../compress/flate/matchlen_generic.go | 15 +- .../klauspost/compress/flate/stateless.go | 13 +- .../klauspost/compress/huff0/bitreader.go | 25 +- .../klauspost/compress/internal/le/le.go | 5 + .../compress/internal/le/unsafe_disabled.go | 42 + .../compress/internal/le/unsafe_enabled.go | 55 + .../klauspost/compress/s2/README.md | 2 +- .../klauspost/compress/s2/decode_other.go | 26 +- .../klauspost/compress/s2/encode_all.go | 422 ++++- .../klauspost/compress/s2/encode_better.go | 416 ++++- .../klauspost/compress/s2/encode_go.go | 12 + vendor/github.com/klauspost/compress/s2sx.mod | 3 +- .../klauspost/compress/zstd/README.md | 2 +- .../klauspost/compress/zstd/bitreader.go | 37 +- .../klauspost/compress/zstd/blockdec.go | 19 - .../klauspost/compress/zstd/blockenc.go | 27 +- .../klauspost/compress/zstd/decoder.go | 3 +- .../klauspost/compress/zstd/enc_base.go | 2 +- .../compress/zstd/matchlen_generic.go | 11 +- .../klauspost/compress/zstd/seqdec.go | 2 +- .../klauspost/compress/zstd/seqdec_amd64.s | 64 +- .../klauspost/compress/zstd/seqdec_generic.go | 2 +- .../klauspost/compress/zstd/seqenc.go | 2 - .../klauspost/compress/zstd/snappy.go | 4 +- .../klauspost/compress/zstd/zstd.go | 7 +- .../klauspost/cpuid/v2/.goreleaser.yml | 23 +- .../github.com/klauspost/cpuid/v2/README.md | 7 + vendor/github.com/klauspost/cpuid/v2/cpuid.go | 92 +- .../klauspost/cpuid/v2/cpuid_arm64.s | 10 + .../klauspost/cpuid/v2/detect_arm64.go | 17 +- .../klauspost/cpuid/v2/detect_ref.go | 2 + .../klauspost/cpuid/v2/detect_x86.go | 3 + .../klauspost/cpuid/v2/featureid_string.go | 446 ++--- .../klauspost/cpuid/v2/os_darwin_arm64.go | 6 + .../klauspost/cpuid/v2/os_linux_arm64.go | 78 + .../mailru/easyjson/jlexer/bytestostr.go | 5 +- .../mailru/easyjson/jlexer/lexer.go | 113 +- .../mailru/easyjson/jwriter/writer.go | 12 + vendor/github.com/minio/crc64nvme/LICENSE | 202 +++ vendor/github.com/minio/crc64nvme/README.md | 20 + vendor/github.com/minio/crc64nvme/crc64.go | 180 +++ .../github.com/minio/crc64nvme/crc64_amd64.go | 15 + .../github.com/minio/crc64nvme/crc64_amd64.s | 157 ++ .../github.com/minio/crc64nvme/crc64_arm64.go | 15 + .../github.com/minio/crc64nvme/crc64_arm64.s | 157 ++ .../github.com/minio/crc64nvme/crc64_other.go | 11 + .../minio/minio-go/v7/.golangci.yml | 85 +- .../minio/minio-go/v7/api-append-object.go | 226 +++ .../minio-go/v7/api-bucket-notification.go | 10 +- .../minio-go/v7/api-bucket-versioning.go | 1 + .../minio/minio-go/v7/api-compose-object.go | 9 +- .../minio/minio-go/v7/api-copy-object.go | 2 +- .../minio/minio-go/v7/api-datatypes.go | 4 + .../minio/minio-go/v7/api-get-object-acl.go | 12 +- .../github.com/minio/minio-go/v7/api-list.go | 66 +- .../minio/minio-go/v7/api-presigned.go | 2 +- .../minio-go/v7/api-put-object-multipart.go | 1 + .../minio-go/v7/api-put-object-streaming.go | 2 +- .../minio/minio-go/v7/api-put-object.go | 5 +- .../minio/minio-go/v7/api-remove.go | 13 +- .../minio/minio-go/v7/api-s3-datatypes.go | 2 +- .../minio/minio-go/v7/api-select.go | 2 - vendor/github.com/minio/minio-go/v7/api.go | 85 +- .../minio/minio-go/v7/bucket-cache.go | 2 +- .../github.com/minio/minio-go/v7/checksum.go | 52 +- .../minio/minio-go/v7/hook-reader.go | 10 +- .../v7/pkg/credentials/assume_role.go | 48 +- .../minio-go/v7/pkg/credentials/chain.go | 18 + .../v7/pkg/credentials/credentials.go | 48 +- .../minio-go/v7/pkg/credentials/env_aws.go | 13 +- .../minio-go/v7/pkg/credentials/env_minio.go | 13 +- .../pkg/credentials/file_aws_credentials.go | 15 +- .../v7/pkg/credentials/file_minio_client.go | 15 +- .../minio-go/v7/pkg/credentials/iam_aws.go | 44 +- .../minio-go/v7/pkg/credentials/static.go | 5 + .../v7/pkg/credentials/sts_client_grants.go | 42 +- .../v7/pkg/credentials/sts_custom_identity.go | 42 +- .../v7/pkg/credentials/sts_ldap_identity.go | 46 +- .../v7/pkg/credentials/sts_tls_identity.go | 106 +- .../v7/pkg/credentials/sts_web_identity.go | 50 +- .../minio-go/v7/pkg/lifecycle/lifecycle.go | 6 +- .../v7/pkg/notification/notification.go | 9 +- .../v7/pkg/replication/replication.go | 48 +- .../minio/minio-go/v7/pkg/s3utils/utils.go | 60 +- ...st-signature-streaming-unsigned-trailer.go | 1 - .../pkg/signer/request-signature-streaming.go | 1 - .../v7/pkg/signer/request-signature-v2.go | 2 +- .../v7/pkg/signer/request-signature-v4.go | 27 +- .../minio/minio-go/v7/retry-continous.go | 26 +- vendor/github.com/minio/minio-go/v7/retry.go | 28 +- .../minio/minio-go/v7/s3-endpoints.go | 12 + vendor/github.com/minio/minio-go/v7/utils.go | 12 +- .../opentracing-contrib/go-grpc/.golangci.yml | 98 +- .../opentracing-contrib/go-grpc/client.go | 16 +- .../opentracing-contrib/go-grpc/server.go | 7 +- .../prometheus/client_golang/api/client.go | 5 +- .../client_golang/api/prometheus/v1/api.go | 40 +- .../client_golang/prometheus/collectorfunc.go | 30 + .../client_golang/prometheus/promhttp/http.go | 26 +- .../promhttp/internal/compression.go | 21 + .../prometheus/common/config/headers.go | 6 +- .../prometheus/common/model/alert.go | 2 +- .../prometheus/common/model/labels.go | 2 +- .../prometheus/common/model/metric.go | 28 +- .../prometheus/common/promslog/slog.go | 222 ++- .../prometheus/procfs/.golangci.yml | 63 +- .../prometheus/procfs/Makefile.common | 10 +- vendor/github.com/prometheus/procfs/README.md | 6 +- vendor/github.com/prometheus/procfs/arp.go | 4 +- vendor/github.com/prometheus/procfs/fs.go | 10 +- .../prometheus/procfs/fs_statfs_notype.go | 4 +- .../github.com/prometheus/procfs/fscache.go | 6 +- .../prometheus/procfs/internal/fs/fs.go | 3 + .../prometheus/procfs/internal/util/parse.go | 14 + .../procfs/internal/util/sysreadfile.go | 20 + .../prometheus/procfs/mountstats.go | 27 +- .../prometheus/procfs/net_dev_snmp6.go | 96 ++ .../prometheus/procfs/net_ip_socket.go | 8 +- .../prometheus/procfs/net_protocols.go | 21 +- .../github.com/prometheus/procfs/net_tcp.go | 4 + .../github.com/prometheus/procfs/net_unix.go | 8 +- vendor/github.com/prometheus/procfs/proc.go | 8 +- .../prometheus/procfs/proc_cgroup.go | 2 +- .../github.com/prometheus/procfs/proc_io.go | 2 +- .../prometheus/procfs/proc_netstat.go | 224 +-- .../prometheus/procfs/proc_smaps.go | 4 +- .../github.com/prometheus/procfs/proc_snmp.go | 120 +- .../prometheus/procfs/proc_snmp6.go | 150 +- .../prometheus/procfs/proc_status.go | 18 +- .../github.com/prometheus/procfs/proc_sys.go | 2 +- .../github.com/prometheus/procfs/softirqs.go | 22 +- vendor/github.com/spf13/afero/.editorconfig | 12 + vendor/github.com/spf13/afero/.golangci.yaml | 18 + vendor/github.com/spf13/afero/README.md | 41 +- vendor/github.com/spf13/afero/iofs.go | 1 - vendor/github.com/spf13/afero/memmap.go | 2 - vendor/github.com/tjhop/slog-gokit/README.md | 10 + vendor/github.com/tjhop/slog-gokit/handler.go | 24 +- .../go.etcd.io/etcd/api/v3/version/version.go | 2 +- vendor/go.etcd.io/etcd/client/v3/lease.go | 12 +- .../pdata/pcommon/generated_byteslice.go | 19 + .../pdata/pcommon/generated_float64slice.go | 19 + .../pdata/pcommon/generated_int32slice.go | 19 + .../pdata/pcommon/generated_int64slice.go | 19 + .../pdata/pcommon/generated_stringslice.go | 19 + .../pdata/pcommon/generated_uint64slice.go | 19 + .../collector/pdata/pcommon/map.go | 43 +- .../collector/pdata/pcommon/slice.go | 31 + .../collector/pdata/pcommon/timestamp.go | 4 +- .../collector/pdata/pcommon/value.go | 31 +- .../pdata/plog/generated_logrecordslice.go | 16 + .../pdata/plog/generated_resourcelogsslice.go | 16 + .../pdata/plog/generated_scopelogsslice.go | 16 + .../collector/pdata/plog/pb.go | 12 + .../pdata/pmetric/generated_exemplarslice.go | 17 + ...ated_exponentialhistogramdatapointslice.go | 16 + .../generated_histogramdatapointslice.go | 16 + .../pdata/pmetric/generated_metricslice.go | 16 + .../pmetric/generated_numberdatapointslice.go | 16 + .../pmetric/generated_resourcemetricsslice.go | 16 + .../pmetric/generated_scopemetricsslice.go | 16 + .../generated_summarydatapointslice.go | 16 + ...ed_summarydatapointvalueatquantileslice.go | 16 + .../collector/pdata/pmetric/pb.go | 28 + .../ptrace/generated_resourcespansslice.go | 16 + .../pdata/ptrace/generated_scopespansslice.go | 16 + .../pdata/ptrace/generated_spaneventslice.go | 16 + .../pdata/ptrace/generated_spanlinkslice.go | 16 + .../pdata/ptrace/generated_spanslice.go | 16 + .../collector/pdata/ptrace/pb.go | 12 + .../otel/exporters/otlp/otlptrace/version.go | 2 +- vendor/golang.org/x/crypto/cryptobyte/asn1.go | 2 +- .../x/crypto/internal/poly1305/mac_noasm.go | 2 +- .../poly1305/{sum_amd64.go => sum_asm.go} | 2 +- .../x/crypto/internal/poly1305/sum_loong64.s | 123 ++ .../x/crypto/internal/poly1305/sum_ppc64x.go | 47 - vendor/golang.org/x/exp/LICENSE | 4 +- .../x/exp/constraints/constraints.go | 2 + vendor/golang.org/x/exp/slices/cmp.go | 44 - vendor/golang.org/x/exp/slices/slices.go | 416 +---- vendor/golang.org/x/exp/slices/sort.go | 143 +- .../golang.org/x/exp/slices/zsortanyfunc.go | 479 ------ .../golang.org/x/exp/slices/zsortordered.go | 481 ------ vendor/golang.org/x/oauth2/google/default.go | 12 + .../google/externalaccount/basecredentials.go | 32 + vendor/golang.org/x/sync/errgroup/errgroup.go | 3 +- vendor/golang.org/x/sys/cpu/cpu.go | 12 + .../golang.org/x/sys/cpu/cpu_linux_loong64.go | 22 + .../golang.org/x/sys/cpu/cpu_linux_noinit.go | 2 +- vendor/golang.org/x/sys/cpu/cpu_loong64.go | 38 + vendor/golang.org/x/sys/cpu/cpu_loong64.s | 13 + vendor/golang.org/x/sys/cpu/parse.go | 4 +- .../golang.org/x/sys/unix/syscall_darwin.go | 149 +- vendor/golang.org/x/sys/unix/syscall_linux.go | 42 +- .../x/sys/unix/zsyscall_darwin_amd64.go | 84 + .../x/sys/unix/zsyscall_darwin_amd64.s | 20 + .../x/sys/unix/zsyscall_darwin_arm64.go | 84 + .../x/sys/unix/zsyscall_darwin_arm64.s | 20 + .../golang.org/x/sys/windows/registry/key.go | 13 +- .../x/sys/windows/registry/value.go | 6 +- .../golang.org/x/sys/windows/types_windows.go | 27 + vendor/golang.org/x/time/rate/rate.go | 28 +- .../googleapis/api/annotations/client.pb.go | 292 ++-- .../googleapis/api/annotations/http.pb.go | 6 +- .../googleapis/api/annotations/resource.pb.go | 5 +- .../googleapis/api/annotations/routing.pb.go | 2 +- .../protobuf/encoding/protojson/decode.go | 5 - .../protobuf/encoding/prototext/decode.go | 5 - .../editiondefaults/editions_defaults.binpb | Bin 138 -> 146 bytes .../protobuf/internal/encoding/tag/tag.go | 8 +- .../protobuf/internal/filedesc/desc.go | 9 +- .../protobuf/internal/filedesc/desc_lazy.go | 9 - .../protobuf/internal/filedesc/editions.go | 3 + .../protobuf/internal/filetype/build.go | 2 +- .../protobuf/internal/flags/flags.go | 7 +- .../protobuf/internal/genid/descriptor_gen.go | 16 + .../protobuf/internal/genid/goname.go | 5 - .../protobuf/internal/impl/codec_field.go | 75 - .../protobuf/internal/impl/codec_message.go | 3 - .../internal/impl/codec_message_opaque.go | 3 - .../protobuf/internal/impl/lazy.go | 2 +- .../protobuf/internal/impl/legacy_message.go | 5 +- .../protobuf/internal/impl/message.go | 13 - .../protobuf/internal/impl/message_opaque.go | 5 - .../protobuf/internal/impl/message_reflect.go | 5 - .../internal/impl/message_reflect_field.go | 76 - .../protobuf/internal/impl/pointer_unsafe.go | 1 - .../protobuf/internal/impl/validate.go | 24 +- .../protobuf/internal/impl/weak.go | 74 - ...ings_unsafe_go121.go => strings_unsafe.go} | 2 - .../internal/strs/strings_unsafe_go120.go | 94 -- .../protobuf/internal/version/version.go | 2 +- .../protobuf/proto/decode.go | 5 - .../google.golang.org/protobuf/proto/merge.go | 6 + .../protobuf/reflect/protodesc/desc.go | 8 +- .../protobuf/reflect/protodesc/desc_init.go | 1 - .../reflect/protodesc/desc_resolve.go | 26 +- .../reflect/protodesc/desc_validate.go | 12 - .../protobuf/reflect/protodesc/proto.go | 3 - .../reflect/protoreflect/source_gen.go | 2 + .../protobuf/reflect/protoreflect/type.go | 12 +- ...{value_unsafe_go121.go => value_unsafe.go} | 2 - .../protoreflect/value_unsafe_go120.go | 98 -- .../types/descriptorpb/descriptor.pb.go | 1439 +++++++---------- .../types/gofeaturespb/go_features.pb.go | 80 +- .../protobuf/types/known/anypb/any.pb.go | 24 +- .../types/known/durationpb/duration.pb.go | 25 +- .../protobuf/types/known/emptypb/empty.pb.go | 20 +- .../types/known/fieldmaskpb/field_mask.pb.go | 23 +- .../types/known/structpb/struct.pb.go | 74 +- .../types/known/timestamppb/timestamp.pb.go | 25 +- .../types/known/wrapperspb/wrappers.pb.go | 103 +- vendor/modules.txt | 115 +- 287 files changed, 7025 insertions(+), 5291 deletions(-) create mode 100644 vendor/github.com/go-openapi/swag/errors.go delete mode 100644 vendor/github.com/klauspost/compress/flate/matchlen_amd64.go delete mode 100644 vendor/github.com/klauspost/compress/flate/matchlen_amd64.s create mode 100644 vendor/github.com/klauspost/compress/internal/le/le.go create mode 100644 vendor/github.com/klauspost/compress/internal/le/unsafe_disabled.go create mode 100644 vendor/github.com/klauspost/compress/internal/le/unsafe_enabled.go create mode 100644 vendor/github.com/minio/crc64nvme/LICENSE create mode 100644 vendor/github.com/minio/crc64nvme/README.md create mode 100644 vendor/github.com/minio/crc64nvme/crc64.go create mode 100644 vendor/github.com/minio/crc64nvme/crc64_amd64.go create mode 100644 vendor/github.com/minio/crc64nvme/crc64_amd64.s create mode 100644 vendor/github.com/minio/crc64nvme/crc64_arm64.go create mode 100644 vendor/github.com/minio/crc64nvme/crc64_arm64.s create mode 100644 vendor/github.com/minio/crc64nvme/crc64_other.go create mode 100644 vendor/github.com/minio/minio-go/v7/api-append-object.go create mode 100644 vendor/github.com/prometheus/client_golang/prometheus/collectorfunc.go create mode 100644 vendor/github.com/prometheus/client_golang/prometheus/promhttp/internal/compression.go create mode 100644 vendor/github.com/prometheus/procfs/net_dev_snmp6.go create mode 100644 vendor/github.com/spf13/afero/.editorconfig create mode 100644 vendor/github.com/spf13/afero/.golangci.yaml rename vendor/golang.org/x/crypto/internal/poly1305/{sum_amd64.go => sum_asm.go} (94%) create mode 100644 vendor/golang.org/x/crypto/internal/poly1305/sum_loong64.s delete mode 100644 vendor/golang.org/x/crypto/internal/poly1305/sum_ppc64x.go delete mode 100644 vendor/golang.org/x/exp/slices/cmp.go delete mode 100644 vendor/golang.org/x/exp/slices/zsortanyfunc.go delete mode 100644 vendor/golang.org/x/exp/slices/zsortordered.go create mode 100644 vendor/golang.org/x/sys/cpu/cpu_linux_loong64.go create mode 100644 vendor/golang.org/x/sys/cpu/cpu_loong64.s delete mode 100644 vendor/google.golang.org/protobuf/internal/impl/weak.go rename vendor/google.golang.org/protobuf/internal/strs/{strings_unsafe_go121.go => strings_unsafe.go} (99%) delete mode 100644 vendor/google.golang.org/protobuf/internal/strs/strings_unsafe_go120.go rename vendor/google.golang.org/protobuf/reflect/protoreflect/{value_unsafe_go121.go => value_unsafe.go} (99%) delete mode 100644 vendor/google.golang.org/protobuf/reflect/protoreflect/value_unsafe_go120.go diff --git a/go.mod b/go.mod index 6f3e8901ec9..f79a22b166e 100644 --- a/go.mod +++ b/go.mod @@ -16,60 +16,60 @@ require ( github.com/felixge/fgprof v0.9.5 github.com/go-kit/log v0.2.1 github.com/go-openapi/strfmt v0.23.0 - github.com/go-openapi/swag v0.23.0 + github.com/go-openapi/swag v0.23.1 github.com/go-redis/redis/v8 v8.11.5 github.com/gogo/protobuf v1.3.2 github.com/gogo/status v1.1.1 - github.com/golang-migrate/migrate/v4 v4.18.1 + github.com/golang-migrate/migrate/v4 v4.18.2 github.com/golang/protobuf v1.5.4 - github.com/golang/snappy v0.0.4 + github.com/golang/snappy v1.0.0 github.com/gorilla/mux v1.8.1 github.com/grafana/regexp v0.0.0-20240518133315-a468a5bfb3bc github.com/grpc-ecosystem/go-grpc-middleware v1.4.0 - github.com/hashicorp/consul/api v1.31.0 + github.com/hashicorp/consul/api v1.32.0 github.com/hashicorp/go-cleanhttp v0.5.2 github.com/hashicorp/go-sockaddr v1.0.7 github.com/hashicorp/memberlist v0.5.1 github.com/json-iterator/go v1.1.12 - github.com/klauspost/compress v1.17.11 + github.com/klauspost/compress v1.18.0 github.com/lib/pq v1.10.9 - github.com/minio/minio-go/v7 v7.0.82 + github.com/minio/minio-go/v7 v7.0.90 github.com/mitchellh/go-wordwrap v1.0.1 github.com/oklog/ulid v1.3.1 - github.com/opentracing-contrib/go-grpc v0.1.0 + github.com/opentracing-contrib/go-grpc v0.1.2 github.com/opentracing-contrib/go-stdlib v1.1.0 github.com/opentracing/opentracing-go v1.2.0 github.com/pkg/errors v0.9.1 github.com/prometheus/alertmanager v0.28.1 - github.com/prometheus/client_golang v1.21.1 - github.com/prometheus/client_model v0.6.1 - github.com/prometheus/common v0.62.0 + github.com/prometheus/client_golang v1.22.0 + github.com/prometheus/client_model v0.6.2 + github.com/prometheus/common v0.63.0 // Prometheus maps version 2.x.y to tags v0.x.y. github.com/prometheus/prometheus v0.302.1 github.com/segmentio/fasthash v1.0.3 github.com/sony/gobreaker v1.0.0 - github.com/spf13/afero v1.11.0 + github.com/spf13/afero v1.14.0 github.com/stretchr/testify v1.10.0 github.com/thanos-io/objstore v0.0.0-20241111205755-d1dd89d41f97 github.com/thanos-io/promql-engine v0.0.0-20250329215917-4055a112d1ea github.com/thanos-io/thanos v0.38.0 github.com/uber/jaeger-client-go v2.30.0+incompatible github.com/weaveworks/common v0.0.0-20230728070032-dd9e68f319d5 - go.etcd.io/etcd/api/v3 v3.5.17 - go.etcd.io/etcd/client/pkg/v3 v3.5.17 - go.etcd.io/etcd/client/v3 v3.5.17 - go.opentelemetry.io/contrib/propagators/aws v1.33.0 + go.etcd.io/etcd/api/v3 v3.5.21 + go.etcd.io/etcd/client/pkg/v3 v3.5.21 + go.etcd.io/etcd/client/v3 v3.5.21 + go.opentelemetry.io/contrib/propagators/aws v1.35.0 go.opentelemetry.io/otel v1.35.0 - go.opentelemetry.io/otel/bridge/opentracing v1.33.0 - go.opentelemetry.io/otel/exporters/otlp/otlptrace v1.34.0 - go.opentelemetry.io/otel/exporters/otlp/otlptrace/otlptracegrpc v1.34.0 + go.opentelemetry.io/otel/bridge/opentracing v1.35.0 + go.opentelemetry.io/otel/exporters/otlp/otlptrace v1.35.0 + go.opentelemetry.io/otel/exporters/otlp/otlptrace/otlptracegrpc v1.35.0 go.opentelemetry.io/otel/sdk v1.35.0 go.opentelemetry.io/otel/trace v1.35.0 go.uber.org/atomic v1.11.0 - golang.org/x/net v0.38.0 - golang.org/x/sync v0.12.0 - golang.org/x/time v0.9.0 - google.golang.org/grpc v1.70.0 + golang.org/x/net v0.39.0 + golang.org/x/sync v0.13.0 + golang.org/x/time v0.11.0 + google.golang.org/grpc v1.71.1 gopkg.in/yaml.v2 v2.4.0 gopkg.in/yaml.v3 v3.0.1 ) @@ -81,12 +81,12 @@ require ( github.com/google/go-cmp v0.7.0 github.com/hashicorp/golang-lru/v2 v2.0.7 github.com/munnerz/goautoneg v0.0.0-20191010083416-a7dc8b61c822 - github.com/prometheus/procfs v0.15.1 + github.com/prometheus/procfs v0.16.1 github.com/sercand/kuberesolver/v5 v5.1.1 - github.com/tjhop/slog-gokit v0.1.3 - go.opentelemetry.io/collector/pdata v1.24.0 + github.com/tjhop/slog-gokit v0.1.4 + go.opentelemetry.io/collector/pdata v1.30.0 go.uber.org/automaxprocs v1.6.0 - google.golang.org/protobuf v1.36.4 + google.golang.org/protobuf v1.36.6 ) require ( @@ -147,7 +147,7 @@ require ( github.com/go-openapi/runtime v0.28.0 // indirect github.com/go-openapi/spec v0.21.0 // indirect github.com/go-openapi/validate v0.24.0 // indirect - github.com/goccy/go-json v0.10.3 // indirect + github.com/goccy/go-json v0.10.5 // indirect github.com/gofrs/uuid v4.4.0+incompatible // indirect github.com/gogo/googleapis v1.4.0 // indirect github.com/golang-jwt/jwt/v5 v5.2.2 // indirect @@ -159,7 +159,7 @@ require ( github.com/googleapis/enterprise-certificate-proxy v0.3.4 // indirect github.com/googleapis/gax-go/v2 v2.14.1 // indirect github.com/grpc-ecosystem/go-grpc-middleware/v2 v2.1.0 // indirect - github.com/grpc-ecosystem/grpc-gateway/v2 v2.25.1 // indirect + github.com/grpc-ecosystem/grpc-gateway/v2 v2.26.1 // indirect github.com/hashicorp/errwrap v1.1.0 // indirect github.com/hashicorp/go-hclog v1.6.3 // indirect github.com/hashicorp/go-immutable-radix v1.3.1 // indirect @@ -173,11 +173,11 @@ require ( github.com/josharian/intern v1.0.0 // indirect github.com/jpillora/backoff v1.0.0 // indirect github.com/julienschmidt/httprouter v1.3.0 // indirect - github.com/klauspost/cpuid/v2 v2.2.8 // indirect + github.com/klauspost/cpuid/v2 v2.2.10 // indirect github.com/kylelemons/godebug v1.1.0 // indirect github.com/lann/builder v0.0.0-20180802200727-47ae307949d0 // indirect github.com/lann/ps v0.0.0-20150810152359-62de8c46ede0 // indirect - github.com/mailru/easyjson v0.7.7 // indirect + github.com/mailru/easyjson v0.9.0 // indirect github.com/mattn/go-colorable v0.1.13 // indirect github.com/mattn/go-isatty v0.0.20 // indirect github.com/matttproud/golang_protobuf_extensions v1.0.4 // indirect @@ -185,6 +185,7 @@ require ( github.com/mdlayher/vsock v1.2.1 // indirect github.com/metalmatze/signal v0.0.0-20210307161603-1c9aa721a97a // indirect github.com/miekg/dns v1.1.63 // indirect + github.com/minio/crc64nvme v1.0.1 // indirect github.com/minio/md5-simd v1.1.2 // indirect github.com/minio/sha256-simd v1.0.1 // indirect github.com/mitchellh/go-homedir v1.1.0 // indirect @@ -241,18 +242,18 @@ require ( go.uber.org/zap v1.27.0 // indirect go4.org/intern v0.0.0-20230525184215-6c62f75575cb // indirect go4.org/unsafe/assume-no-moving-gc v0.0.0-20230525183740-e7c30c78aeb2 // indirect - golang.org/x/crypto v0.36.0 // indirect - golang.org/x/exp v0.0.0-20240613232115-7f521ea00fb8 // indirect + golang.org/x/crypto v0.37.0 // indirect + golang.org/x/exp v0.0.0-20250106191152-7588d65b2ba8 // indirect golang.org/x/mod v0.24.0 // indirect - golang.org/x/oauth2 v0.25.0 // indirect - golang.org/x/sys v0.31.0 // indirect - golang.org/x/text v0.23.0 // indirect + golang.org/x/oauth2 v0.26.0 // indirect + golang.org/x/sys v0.32.0 // indirect + golang.org/x/text v0.24.0 // indirect golang.org/x/tools v0.31.0 // indirect gonum.org/v1/gonum v0.15.1 // indirect google.golang.org/api v0.218.0 // indirect google.golang.org/genproto v0.0.0-20240823204242-4ba0660f739c // indirect - google.golang.org/genproto/googleapis/api v0.0.0-20250115164207-1a7da9e5054f // indirect - google.golang.org/genproto/googleapis/rpc v0.0.0-20250115164207-1a7da9e5054f // indirect + google.golang.org/genproto/googleapis/api v0.0.0-20250218202821-56aae31c358a // indirect + google.golang.org/genproto/googleapis/rpc v0.0.0-20250218202821-56aae31c358a // indirect gopkg.in/alecthomas/kingpin.v2 v2.2.6 // indirect gopkg.in/telebot.v3 v3.3.8 // indirect k8s.io/apimachinery v0.31.3 // indirect diff --git a/go.sum b/go.sum index e8d52fe8ad6..9b503ebe3d2 100644 --- a/go.sum +++ b/go.sum @@ -955,8 +955,8 @@ github.com/dgryski/go-metro v0.0.0-20200812162917-85c65e2d0165 h1:BS21ZUJ/B5X2UV github.com/dgryski/go-metro v0.0.0-20200812162917-85c65e2d0165/go.mod h1:c9O8+fpSOX1DM8cPNSkX/qsBWdkD4yd2dpciOWQjpBw= github.com/dgryski/go-rendezvous v0.0.0-20200823014737-9f7001d12a5f h1:lO4WD4F/rVNCu3HqELle0jiPLLBs70cWOduZpkS1E78= github.com/dgryski/go-rendezvous v0.0.0-20200823014737-9f7001d12a5f/go.mod h1:cuUVRXasLTGF7a8hSLbxyZXjz+1KgoB3wDUb6vlszIc= -github.com/dhui/dktest v0.4.3 h1:wquqUxAFdcUgabAVLvSCOKOlag5cIZuaOjYIBOWdsR0= -github.com/dhui/dktest v0.4.3/go.mod h1:zNK8IwktWzQRm6I/l2Wjp7MakiyaFWv4G1hjmodmMTs= +github.com/dhui/dktest v0.4.4 h1:+I4s6JRE1yGuqflzwqG+aIaMdgXIorCf5P98JnaAWa8= +github.com/dhui/dktest v0.4.4/go.mod h1:4+22R4lgsdAXrDyaH4Nqx2JEz2hLp49MqQmm9HLCQhM= github.com/digitalocean/godo v1.132.0 h1:n0x6+ZkwbyQBtIU1wwBhv26EINqHg0wWQiBXlwYg/HQ= github.com/digitalocean/godo v1.132.0/go.mod h1:PU8JB6I1XYkQIdHFop8lLAY9ojp6M0XcU0TWaQSxbrc= github.com/distribution/reference v0.6.0 h1:0IXCQ5g4/QMHHkarYzh5l+u8T3t73zM5QvfrDyIgxBk= @@ -1069,8 +1069,8 @@ github.com/go-openapi/strfmt v0.23.0 h1:nlUS6BCqcnAk0pyhi9Y+kdDVZdZMHfEKQiS4HaMg github.com/go-openapi/strfmt v0.23.0/go.mod h1:NrtIpfKtWIygRkKVsxh7XQMDQW5HKQl6S5ik2elW+K4= github.com/go-openapi/swag v0.19.5/go.mod h1:POnQmlKehdgb5mhVOsnJFsivZCEZ/vjK9gh66Z9tfKk= github.com/go-openapi/swag v0.19.15/go.mod h1:QYRuS/SOXUCsnplDa677K7+DxSOj6IPNl/eQntq43wQ= -github.com/go-openapi/swag v0.23.0 h1:vsEVJDUo2hPJ2tu0/Xc+4noaxyEffXNIs3cOULZ+GrE= -github.com/go-openapi/swag v0.23.0/go.mod h1:esZ8ITTYEsH1V2trKHjAN8Ai7xHb8RV+YSZ577vPjgQ= +github.com/go-openapi/swag v0.23.1 h1:lpsStH0n2ittzTnbaSloVZLuB5+fvSY/+hnagBjSNZU= +github.com/go-openapi/swag v0.23.1/go.mod h1:STZs8TbRvEQQKUA+JZNAm3EWlgaOBGpyFDqQnDHMef0= github.com/go-openapi/validate v0.24.0 h1:LdfDKwNbpB6Vn40xhTdNZAnfLECL81w+VX3BumrGD58= github.com/go-openapi/validate v0.24.0/go.mod h1:iyeX1sEufmv3nPbBdX3ieNviWnOZaJ1+zquzJEf2BAQ= github.com/go-pdf/fpdf v0.5.0/go.mod h1:HzcnA+A23uwogo0tp9yU+l3V+KXhiESpt1PMayhOh5M= @@ -1092,8 +1092,8 @@ github.com/gobwas/httphead v0.1.0/go.mod h1:O/RXo79gxV8G+RqlR/otEwx4Q36zl9rqC5u1 github.com/gobwas/pool v0.2.1/go.mod h1:q8bcK0KcYlCgd9e7WYLm9LpyS+YeLd8JVDW6WezmKEw= github.com/gobwas/ws v1.2.1/go.mod h1:hRKAFb8wOxFROYNsT1bqfWnhX+b5MFeJM9r2ZSwg/KY= github.com/goccy/go-json v0.9.11/go.mod h1:6MelG93GURQebXPDq3khkgXZkazVtN9CRI+MGFi0w8I= -github.com/goccy/go-json v0.10.3 h1:KZ5WoDbxAIgm2HNbYckL0se1fHD6rz5j4ywS6ebzDqA= -github.com/goccy/go-json v0.10.3/go.mod h1:oq7eo15ShAhp70Anwd5lgX2pLfOS3QCiwU/PULtXL6M= +github.com/goccy/go-json v0.10.5 h1:Fq85nIqj+gXn/S5ahsiTlK3TmC85qgirsdTP/+DeaC4= +github.com/goccy/go-json v0.10.5/go.mod h1:oq7eo15ShAhp70Anwd5lgX2pLfOS3QCiwU/PULtXL6M= github.com/goccy/go-yaml v1.9.5/go.mod h1:U/jl18uSupI5rdI2jmuCswEA2htH9eXfferR3KfscvA= github.com/godbus/dbus/v5 v5.0.4/go.mod h1:xhWf0FNVPg57R7Z0UbKHbJfkEywrmjJnf7w5xrFpKfA= github.com/gofrs/flock v0.8.1 h1:+gYjHKf32LDeiEEFhQaotPbLuUXjY5ZqxKgXy7n59aw= @@ -1111,8 +1111,8 @@ github.com/gogo/status v1.1.1 h1:DuHXlSFHNKqTQ+/ACf5Vs6r4X/dH2EgIzR9Vr+H65kg= github.com/gogo/status v1.1.1/go.mod h1:jpG3dM5QPcqu19Hg8lkUhBFBa3TcLs1DG7+2Jqci7oU= github.com/golang-jwt/jwt/v5 v5.2.2 h1:Rl4B7itRWVtYIHFrSNd7vhTiz9UpLdi6gZhZ3wEeDy8= github.com/golang-jwt/jwt/v5 v5.2.2/go.mod h1:pqrtFR0X4osieyHYxtmOUWsAWrfe1Q5UVIyoH402zdk= -github.com/golang-migrate/migrate/v4 v4.18.1 h1:JML/k+t4tpHCpQTCAD62Nu43NUFzHY4CV3uAuvHGC+Y= -github.com/golang-migrate/migrate/v4 v4.18.1/go.mod h1:HAX6m3sQgcdO81tdjn5exv20+3Kb13cmGli1hrD6hks= +github.com/golang-migrate/migrate/v4 v4.18.2 h1:2VSCMz7x7mjyTXx3m2zPokOY82LTRgxK1yQYKo6wWQ8= +github.com/golang-migrate/migrate/v4 v4.18.2/go.mod h1:2CM6tJvn2kqPXwnXO/d3rAQYiyoIm180VsO8PRX6Rpk= github.com/golang/freetype v0.0.0-20170609003504-e2365dfdc4a0/go.mod h1:E/TSTwGwJL78qG/PmXZO1EjYhfJinVAhrmmHX6Z8B9k= github.com/golang/glog v0.0.0-20160126235308-23def4e6c14b/go.mod h1:SBH7ygxi8pfUlaOkMMuAQtPIUF8ecWP5IEl/CR7VP2Q= github.com/golang/glog v1.0.0/go.mod h1:EWib/APOK0SL3dFbYqvxE3UYd8E6s1ouQ7iEp/0LWV4= @@ -1152,8 +1152,9 @@ github.com/golang/protobuf v1.5.3/go.mod h1:XVQd3VNwM+JqD3oG2Ue2ip4fOMUkwXdXDdiu github.com/golang/protobuf v1.5.4 h1:i7eJL8qZTpSEXOPTxNKhASYpMn+8e5Q6AdndVa1dWek= github.com/golang/protobuf v1.5.4/go.mod h1:lnTiLA8Wa4RWRcIUkrtSVa5nRhsEGBg48fD6rSs7xps= github.com/golang/snappy v0.0.3/go.mod h1:/XxbfmMg8lxefKM7IXC3fBNl/7bRcc72aCRzEWrmP2Q= -github.com/golang/snappy v0.0.4 h1:yAGX7huGHXlcLOEtBnF4w7FQwA26wojNCwOYAEhLjQM= github.com/golang/snappy v0.0.4/go.mod h1:/XxbfmMg8lxefKM7IXC3fBNl/7bRcc72aCRzEWrmP2Q= +github.com/golang/snappy v1.0.0 h1:Oy607GVXHs7RtbggtPBnr2RmDArIsAefDwvrdWvRhGs= +github.com/golang/snappy v1.0.0/go.mod h1:/XxbfmMg8lxefKM7IXC3fBNl/7bRcc72aCRzEWrmP2Q= github.com/google/btree v0.0.0-20180813153112-4030bb1f1f0c/go.mod h1:lNA+9X1NB3Zf8V7Ke586lFgjr2dZNuvo3lPJSGZ5JPQ= github.com/google/btree v1.0.0/go.mod h1:lNA+9X1NB3Zf8V7Ke586lFgjr2dZNuvo3lPJSGZ5JPQ= github.com/google/btree v1.1.2 h1:xf4v41cLI2Z6FxbKm+8Bu+m8ifhj15JuZ9sa0jZCMUU= @@ -1264,11 +1265,11 @@ github.com/grpc-ecosystem/grpc-gateway v1.16.0/go.mod h1:BDjrQk3hbvj6Nolgz8mAMFb github.com/grpc-ecosystem/grpc-gateway/v2 v2.7.0/go.mod h1:hgWBS7lorOAVIJEQMi4ZsPv9hVvWI6+ch50m39Pf2Ks= github.com/grpc-ecosystem/grpc-gateway/v2 v2.11.3/go.mod h1:o//XUCC/F+yRGJoPO/VU0GSB0f8Nhgmxx0VIRUvaC0w= github.com/grpc-ecosystem/grpc-gateway/v2 v2.16.0/go.mod h1:YN5jB8ie0yfIUg6VvR9Kz84aCaG7AsGZnLjhHbUqwPg= -github.com/grpc-ecosystem/grpc-gateway/v2 v2.25.1 h1:VNqngBF40hVlDloBruUehVYC3ArSgIyScOAyMRqBxRg= -github.com/grpc-ecosystem/grpc-gateway/v2 v2.25.1/go.mod h1:RBRO7fro65R6tjKzYgLAFo0t1QEXY1Dp+i/bvpRiqiQ= +github.com/grpc-ecosystem/grpc-gateway/v2 v2.26.1 h1:e9Rjr40Z98/clHv5Yg79Is0NtosR5LXRvdr7o/6NwbA= +github.com/grpc-ecosystem/grpc-gateway/v2 v2.26.1/go.mod h1:tIxuGz/9mpox++sgp9fJjHO0+q1X9/UOWd798aAm22M= github.com/hashicorp/consul/api v1.12.0/go.mod h1:6pVBMo0ebnYdt2S3H87XhekM/HHrUoTD2XXb/VrZVy0= -github.com/hashicorp/consul/api v1.31.0 h1:32BUNLembeSRek0G/ZAM6WNfdEwYdYo8oQ4+JoqGkNQ= -github.com/hashicorp/consul/api v1.31.0/go.mod h1:2ZGIiXM3A610NmDULmCHd/aqBJj8CkMfOhswhOafxRg= +github.com/hashicorp/consul/api v1.32.0 h1:5wp5u780Gri7c4OedGEPzmlUEzi0g2KyiPphSr6zjVg= +github.com/hashicorp/consul/api v1.32.0/go.mod h1:Z8YgY0eVPukT/17ejW+l+C7zJmKwgPHtjU1q16v/Y40= github.com/hashicorp/consul/sdk v0.8.0/go.mod h1:GBvyrGALthsZObzUGsfgHZQDXjg4lOjagTIwIR1vPms= github.com/hashicorp/consul/sdk v0.16.1 h1:V8TxTnImoPD5cj0U9Spl0TUxcytjcbbJeADFF07KdHg= github.com/hashicorp/consul/sdk v0.16.1/go.mod h1:fSXvwxB2hmh1FMZCNl6PwX0Q/1wdWtHJcZ7Ea5tns0s= @@ -1370,12 +1371,12 @@ github.com/kisielk/errcheck v1.5.0/go.mod h1:pFxgyoBC7bSaBwPgfKdkLd5X25qrDl4LWUI github.com/kisielk/gotool v1.0.0/go.mod h1:XhKaO+MFFWcvkIS/tQcRk01m1F5IRFswLeQ+oQHNcck= github.com/klauspost/asmfmt v1.3.2/go.mod h1:AG8TuvYojzulgDAMCnYn50l/5QV3Bs/tp6j0HLHbNSE= github.com/klauspost/compress v1.15.9/go.mod h1:PhcZ0MbTNciWF3rruxRgKxI5NkcHHrHUDtV4Yw2GlzU= -github.com/klauspost/compress v1.17.11 h1:In6xLpyWOi1+C7tXUUWv2ot1QvBjxevKAaI6IXrJmUc= -github.com/klauspost/compress v1.17.11/go.mod h1:pMDklpSncoRMuLFrf1W9Ss9KT+0rH90U12bZKk7uwG0= +github.com/klauspost/compress v1.18.0 h1:c/Cqfb0r+Yi+JtIEq73FWXVkRonBlf0CRNYc8Zttxdo= +github.com/klauspost/compress v1.18.0/go.mod h1:2Pp+KzxcywXVXMr50+X0Q/Lsb43OQHYWRCY2AiWywWQ= github.com/klauspost/cpuid/v2 v2.0.1/go.mod h1:FInQzS24/EEf25PyTYn52gqo7WaD8xa0213Md/qVLRg= github.com/klauspost/cpuid/v2 v2.0.9/go.mod h1:FInQzS24/EEf25PyTYn52gqo7WaD8xa0213Md/qVLRg= -github.com/klauspost/cpuid/v2 v2.2.8 h1:+StwCXwm9PdpiEkPyzBXIy+M9KUb4ODm0Zarf1kS5BM= -github.com/klauspost/cpuid/v2 v2.2.8/go.mod h1:Lcz8mBdAVJIBVzewtcLocK12l3Y+JytZYpaMropDUws= +github.com/klauspost/cpuid/v2 v2.2.10 h1:tBs3QSyvjDyFTq3uoc/9xFpCuOsJQFNPiAhYdw2skhE= +github.com/klauspost/cpuid/v2 v2.2.10/go.mod h1:hqwkgyIinND0mEev00jJYCxPNVRVXFQeu1XKlok6oO0= github.com/knadh/koanf/maps v0.1.1 h1:G5TjmUh2D7G2YWf5SQQqSiHRJEjaicvU0KpypqB3NIs= github.com/knadh/koanf/maps v0.1.1/go.mod h1:npD/QZY3V6ghQDdcQzl1W4ICNVTkohC8E73eI2xW4yI= github.com/knadh/koanf/providers/confmap v0.1.0 h1:gOkxhHkemwG4LezxxN8DMOFopOPghxRVp7JbIvdvqzU= @@ -1422,8 +1423,9 @@ github.com/magiconair/properties v1.8.6/go.mod h1:y3VJvCyxH9uVvJTWEGAELF3aiYNyPK github.com/mailru/easyjson v0.0.0-20190614124828-94de47d64c63/go.mod h1:C1wdFJiN94OJF2b5HbByQZoLdCWB1Yqtg26g4irojpc= github.com/mailru/easyjson v0.0.0-20190626092158-b2ccc519800e/go.mod h1:C1wdFJiN94OJF2b5HbByQZoLdCWB1Yqtg26g4irojpc= github.com/mailru/easyjson v0.7.6/go.mod h1:xzfreul335JAWq5oZzymOObrkdz5UnU4kGfJJLY9Nlc= -github.com/mailru/easyjson v0.7.7 h1:UGYAvKxe3sBsEDzO8ZeWOSlIQfWFlxbzLZe7hwFURr0= github.com/mailru/easyjson v0.7.7/go.mod h1:xzfreul335JAWq5oZzymOObrkdz5UnU4kGfJJLY9Nlc= +github.com/mailru/easyjson v0.9.0 h1:PrnmzHw7262yW8sTBwxi1PdJA3Iw/EKBa8psRf7d9a4= +github.com/mailru/easyjson v0.9.0/go.mod h1:1+xMtQp2MRNVL/V1bOzuP3aP8VNwRW55fQUto+XFtTU= github.com/mattn/go-colorable v0.0.9/go.mod h1:9vuHe8Xs5qXnSaW/c/ABM9alt+Vo+STaOChaDxuIBZU= github.com/mattn/go-colorable v0.1.4/go.mod h1:U0ppj6V5qS13XJ6of8GYAs25YV2eR4EVcfRqFIhoBtE= github.com/mattn/go-colorable v0.1.6/go.mod h1:u6P/XSegPjTcexA+o6vUJrdnUu04hMope9wVRipJSqc= @@ -1459,10 +1461,12 @@ github.com/miekg/dns v1.1.63 h1:8M5aAw6OMZfFXTT7K5V0Eu5YiiL8l7nUAkyN6C9YwaY= github.com/miekg/dns v1.1.63/go.mod h1:6NGHfjhpmr5lt3XPLuyfDJi5AXbNIPM9PY6H6sF1Nfs= github.com/minio/asm2plan9s v0.0.0-20200509001527-cdd76441f9d8/go.mod h1:mC1jAcsrzbxHt8iiaC+zU4b1ylILSosueou12R++wfY= github.com/minio/c2goasm v0.0.0-20190812172519-36a3d3bbc4f3/go.mod h1:RagcQ7I8IeTMnF8JTXieKnO4Z6JCsikNEzj0DwauVzE= +github.com/minio/crc64nvme v1.0.1 h1:DHQPrYPdqK7jQG/Ls5CTBZWeex/2FMS3G5XGkycuFrY= +github.com/minio/crc64nvme v1.0.1/go.mod h1:eVfm2fAzLlxMdUGc0EEBGSMmPwmXD5XiNRpnu9J3bvg= github.com/minio/md5-simd v1.1.2 h1:Gdi1DZK69+ZVMoNHRXJyNcxrMA4dSxoYHZSQbirFg34= github.com/minio/md5-simd v1.1.2/go.mod h1:MzdKDxYpY2BT9XQFocsiZf/NKVtR7nkE4RoEpN+20RM= -github.com/minio/minio-go/v7 v7.0.82 h1:tWfICLhmp2aFPXL8Tli0XDTHj2VB/fNf0PC1f/i1gRo= -github.com/minio/minio-go/v7 v7.0.82/go.mod h1:84gmIilaX4zcvAWWzJ5Z1WI5axN+hAbM5w25xf8xvC0= +github.com/minio/minio-go/v7 v7.0.90 h1:TmSj1083wtAD0kEYTx7a5pFsv3iRYMsOJ6A4crjA1lE= +github.com/minio/minio-go/v7 v7.0.90/go.mod h1:uvMUcGrpgeSAAI6+sD3818508nUyMULw94j2Nxku/Go= github.com/minio/sha256-simd v1.0.1 h1:6kaan5IFmwTNynnKKpDHe6FWHohJOHhCPchzK49dzMM= github.com/minio/sha256-simd v1.0.1/go.mod h1:Pz6AKMiUdngCLpeTL/RJY1M9rUuPMYujV5xJjtbRSN8= github.com/mitchellh/cli v1.1.0/go.mod h1:xcISNoH86gajksDmfB23e/pu+B+GeFRMYmoHXxx3xhI= @@ -1525,8 +1529,8 @@ github.com/opencontainers/go-digest v1.0.0 h1:apOUWs51W5PlhuyGyz9FCeeBIOUDA/6nW8 github.com/opencontainers/go-digest v1.0.0/go.mod h1:0JzlMkj0TRzQZfJkVvzbP0HBR3IKzErnv2BNG4W4MAM= github.com/opencontainers/image-spec v1.1.0 h1:8SG7/vwALn54lVB/0yZ/MMwhFrPYtpEHQb2IpWsCzug= github.com/opencontainers/image-spec v1.1.0/go.mod h1:W4s4sFTMaBeK1BQLXbG4AdM2szdn85PY75RI83NrTrM= -github.com/opentracing-contrib/go-grpc v0.1.0 h1:9JHDtQXv6UL0tFF8KJB/4ApJgeOcaHp1h07d0PJjESc= -github.com/opentracing-contrib/go-grpc v0.1.0/go.mod h1:i3/jx/TvJZ/HKidtT4XGIi/NosUEpzS9xjVJctbKZzI= +github.com/opentracing-contrib/go-grpc v0.1.2 h1:MP16Ozc59kqqwn1v18aQxpeGZhsBanJ2iurZYaQSZ+g= +github.com/opentracing-contrib/go-grpc v0.1.2/go.mod h1:glU6rl1Fhfp9aXUHkE36K2mR4ht8vih0ekOVlWKEUHM= github.com/opentracing-contrib/go-stdlib v1.1.0 h1:cZBWc4pA4e65tqTJddbflK435S0tDImj6c9BMvkdUH0= github.com/opentracing-contrib/go-stdlib v1.1.0/go.mod h1:S0p+X9p6dcBkoMTL+Qq2VOvxKs9ys5PpYWXWqlCS0bQ= github.com/opentracing/opentracing-go v1.1.0/go.mod h1:UkNAQd3GIcIGf0SeVgPpRdFStlNbqXla1AfSYxPUl2o= @@ -1572,22 +1576,22 @@ github.com/prometheus/client_golang v1.4.0/go.mod h1:e9GMxYsXl05ICDXkRhurwBS4Q3O github.com/prometheus/client_golang v1.5.1/go.mod h1:e9GMxYsXl05ICDXkRhurwBS4Q3OK1iX/F2sw+iXX5zU= github.com/prometheus/client_golang v1.7.1/go.mod h1:PY5Wy2awLA44sXw4AOSfFBetzPP4j5+D6mVACh+pe2M= github.com/prometheus/client_golang v1.11.1/go.mod h1:Z6t4BnS23TR94PD6BsDNk8yVqroYurpAkEiz0P2BEV0= -github.com/prometheus/client_golang v1.21.1 h1:DOvXXTqVzvkIewV/CDPFdejpMCGeMcbGCQ8YOmu+Ibk= -github.com/prometheus/client_golang v1.21.1/go.mod h1:U9NM32ykUErtVBxdvD3zfi+EuFkkaBvMb09mIfe0Zgg= +github.com/prometheus/client_golang v1.22.0 h1:rb93p9lokFEsctTys46VnV1kLCDpVZ0a/Y92Vm0Zc6Q= +github.com/prometheus/client_golang v1.22.0/go.mod h1:R7ljNsLXhuQXYZYtw6GAE9AZg8Y7vEW5scdCXrWRXC0= github.com/prometheus/client_model v0.0.0-20180712105110-5c3871d89910/go.mod h1:MbSGuTsp3dbXC40dX6PRTWyKYBIrTGTE9sqQNg2J8bo= github.com/prometheus/client_model v0.0.0-20190129233127-fd36f4220a90/go.mod h1:xMI15A0UPsDsEKsMN9yxemIoYk6Tm2C1GtYGdfGttqA= github.com/prometheus/client_model v0.0.0-20190812154241-14fe0d1b01d4/go.mod h1:xMI15A0UPsDsEKsMN9yxemIoYk6Tm2C1GtYGdfGttqA= github.com/prometheus/client_model v0.2.0/go.mod h1:xMI15A0UPsDsEKsMN9yxemIoYk6Tm2C1GtYGdfGttqA= github.com/prometheus/client_model v0.3.0/go.mod h1:LDGWKZIo7rky3hgvBe+caln+Dr3dPggB5dvjtD7w9+w= github.com/prometheus/client_model v0.5.0/go.mod h1:dTiFglRmd66nLR9Pv9f0mZi7B7fk5Pm3gvsjB5tr+kI= -github.com/prometheus/client_model v0.6.1 h1:ZKSh/rekM+n3CeS952MLRAdFwIKqeY8b62p8ais2e9E= -github.com/prometheus/client_model v0.6.1/go.mod h1:OrxVMOVHjw3lKMa8+x6HeMGkHMQyHDk9E3jmP2AmGiY= +github.com/prometheus/client_model v0.6.2 h1:oBsgwpGs7iVziMvrGhE53c/GrLUsZdHnqNwqPLxwZyk= +github.com/prometheus/client_model v0.6.2/go.mod h1:y3m2F6Gdpfy6Ut/GBsUqTWZqCUvMVzSfMLjcu6wAwpE= github.com/prometheus/common v0.4.1/go.mod h1:TNfzLD0ON7rHzMJeJkieUDPYmFC7Snx/y86RQel1bk4= github.com/prometheus/common v0.9.1/go.mod h1:yhUN8i9wzaXS3w1O07YhxHEBxD+W35wd8bs7vj7HSQ4= github.com/prometheus/common v0.10.0/go.mod h1:Tlit/dnDKsSWFlCLTWaA1cyBgKHSMdTB80sz/V91rCo= github.com/prometheus/common v0.26.0/go.mod h1:M7rCNAaPfAosfx8veZJCuw84e35h3Cfd9VFqTh1DIvc= -github.com/prometheus/common v0.62.0 h1:xasJaQlnWAeyHdUBeGjXmutelfJHWMRr+Fg4QszZ2Io= -github.com/prometheus/common v0.62.0/go.mod h1:vyBcEuLSvWos9B1+CyL7JZ2up+uFzXhkqml0W5zIY1I= +github.com/prometheus/common v0.63.0 h1:YR/EIY1o3mEFP/kZCD7iDMnLPlGyuU2Gb3HIcXnA98k= +github.com/prometheus/common v0.63.0/go.mod h1:VVFF/fBIoToEnWRVkYoXEkq3R3paCoxG9PXP74SnV18= github.com/prometheus/exporter-toolkit v0.13.2 h1:Z02fYtbqTMy2i/f+xZ+UK5jy/bl1Ex3ndzh06T/Q9DQ= github.com/prometheus/exporter-toolkit v0.13.2/go.mod h1:tCqnfx21q6qN1KA4U3Bfb8uWzXfijIrJz3/kTIqMV7g= github.com/prometheus/procfs v0.0.0-20181005140218-185b4288413d/go.mod h1:c3At6R/oaqEKCNdg8wHV1ftS6bRYblBhIjjI8uT2IGk= @@ -1595,8 +1599,8 @@ github.com/prometheus/procfs v0.0.2/go.mod h1:TjEm7ze935MbeOT/UhFTIMYKhuLP4wbCsT github.com/prometheus/procfs v0.0.8/go.mod h1:7Qr8sr6344vo1JqZ6HhLceV9o3AJ1Ff+GxbHq6oeK9A= github.com/prometheus/procfs v0.1.3/go.mod h1:lV6e/gmhEcM9IjHGsFOCxxuZ+z1YqCvr4OA4YeYWdaU= github.com/prometheus/procfs v0.6.0/go.mod h1:cz+aTbrPOrUb4q7XlbU9ygM+/jj0fzG6c1xBZuNvfVA= -github.com/prometheus/procfs v0.15.1 h1:YagwOFzUgYfKKHX6Dr+sHT7km/hxC76UB0learggepc= -github.com/prometheus/procfs v0.15.1/go.mod h1:fB45yRUv8NstnjriLhBQLuOUt+WW4BsoGhij/e3PBqk= +github.com/prometheus/procfs v0.16.1 h1:hZ15bTNuirocR6u0JZ6BAHHmwS1p8B4P6MRqxtzMyRg= +github.com/prometheus/procfs v0.16.1/go.mod h1:teAbpZRB1iIAJYREa1LsoWUXykVXA1KlTmWl8x/U+Is= github.com/prometheus/prometheus v0.302.1 h1:xqVdrwrB4WNpdgJqxsz5loqFWNUZitsK8myqLuSZ6Ag= github.com/prometheus/prometheus v0.302.1/go.mod h1:YcyCoTbUR/TM8rY3Aoeqr0AWTu/pu1Ehh+trpX3eRzg= github.com/prometheus/sigv4 v0.1.1 h1:UJxjOqVcXctZlwDjpUpZ2OiMWJdFijgSofwLzO1Xk0Q= @@ -1649,8 +1653,8 @@ github.com/spf13/afero v1.6.0/go.mod h1:Ai8FlHk4v/PARR026UzYexafAt9roJ7LcLMAmO6Z github.com/spf13/afero v1.8.2/go.mod h1:CtAatgMJh6bJEIs48Ay/FOnkljP3WeGUG0MC1RfAqwo= github.com/spf13/afero v1.9.2/go.mod h1:iUV7ddyEEZPO5gA3zD4fJt6iStLlL+Lg4m2cihcDf8Y= github.com/spf13/afero v1.10.0/go.mod h1:UBogFpq8E9Hx+xc5CNTTEpTnuHVmXDwZcZcE1eb/UhQ= -github.com/spf13/afero v1.11.0 h1:WJQKhtpdm3v2IzqG8VMqrr6Rf3UYpEF239Jy9wNepM8= -github.com/spf13/afero v1.11.0/go.mod h1:GH9Y3pIexgf1MTIWtNGyogA5MwRIDXGUr+hbWNoBjkY= +github.com/spf13/afero v1.14.0 h1:9tH6MapGnn/j0eb0yIXiLjERO8RB6xIVZRDCX7PtqWA= +github.com/spf13/afero v1.14.0/go.mod h1:acJQ8t0ohCGuMN3O+Pv0V0hgMxNYDlvdk+VTfyZmbYo= github.com/spf13/cast v1.5.0/go.mod h1:SpXXQ5YoyJw6s3/6cMTQuxvgRl3PCJiyaX9p6b155UU= github.com/spf13/jwalterweatherman v1.1.0/go.mod h1:aNWZUN0dPAAO/Ljvb5BEdw96iTZ0EXowPYD95IqWIGo= github.com/spf13/pflag v1.0.5 h1:iy+VFUOCP1a+8yFto/drg2CJ5u0yRoB7fZw3DKv/JXA= @@ -1689,8 +1693,8 @@ github.com/thanos-io/promql-engine v0.0.0-20250329215917-4055a112d1ea h1:5dtnkBP github.com/thanos-io/promql-engine v0.0.0-20250329215917-4055a112d1ea/go.mod h1:mRXbmLU+mCzHH16qDGFYYEviXbxxsHFQuAe66rp6sNM= github.com/thanos-io/thanos v0.38.0 h1:rw+wBKmTG1XZcg6AR+NxEou6WUP4f2xlD0ML2WdqXD0= github.com/thanos-io/thanos v0.38.0/go.mod h1:k92PFaWEiFhvI03q6ZjepRxVw6KMKvEXwFW1DWtnuaE= -github.com/tjhop/slog-gokit v0.1.3 h1:6SdexP3UIeg93KLFeiM1Wp1caRwdTLgsD/THxBUy1+o= -github.com/tjhop/slog-gokit v0.1.3/go.mod h1:Bbu5v2748qpAWH7k6gse/kw3076IJf6owJmh7yArmJs= +github.com/tjhop/slog-gokit v0.1.4 h1:uj/vbDt3HaF0Py8bHPV4ti/s0utnO0miRbO277FLBKM= +github.com/tjhop/slog-gokit v0.1.4/go.mod h1:Bbu5v2748qpAWH7k6gse/kw3076IJf6owJmh7yArmJs= github.com/trivago/tgo v1.0.7 h1:uaWH/XIy9aWYWpjm2CU3RpcqZXmX2ysQ9/Go+d9gyrM= github.com/trivago/tgo v1.0.7/go.mod h1:w4dpD+3tzNIIiIfkWWa85w5/B77tlvdZckQ+6PkFnhc= github.com/tv42/httpunix v0.0.0-20150427012821-b75d8614f926/go.mod h1:9ESjWnEqriFuLhtthL60Sar/7RFoluCcXsuvEwTV5KM= @@ -1718,15 +1722,15 @@ github.com/zeebo/xxh3 v1.0.2/go.mod h1:5NWz9Sef7zIDm2JHfFlcQvNekmcEl9ekUZQQKCYaD github.com/zhangyunhao116/umap v0.0.0-20221211160557-cb7705fafa39 h1:D3ltj0b2c2FgUacKrB1pWGgwrUyCESY9W8XYYQ5sqY8= github.com/zhangyunhao116/umap v0.0.0-20221211160557-cb7705fafa39/go.mod h1:r86X1CnsDRrOeLtJlqRWdELPWpkcf933GTlojQlifQw= go.etcd.io/etcd/api/v3 v3.5.4/go.mod h1:5GB2vv4A4AOn3yk7MftYGHkUfGtDHnEraIjym4dYz5A= -go.etcd.io/etcd/api/v3 v3.5.17 h1:cQB8eb8bxwuxOilBpMJAEo8fAONyrdXTHUNcMd8yT1w= -go.etcd.io/etcd/api/v3 v3.5.17/go.mod h1:d1hvkRuXkts6PmaYk2Vrgqbv7H4ADfAKhyJqHNLJCB4= +go.etcd.io/etcd/api/v3 v3.5.21 h1:A6O2/JDb3tvHhiIz3xf9nJ7REHvtEFJJ3veW3FbCnS8= +go.etcd.io/etcd/api/v3 v3.5.21/go.mod h1:c3aH5wcvXv/9dqIw2Y810LDXJfhSYdHQ0vxmP3CCHVY= go.etcd.io/etcd/client/pkg/v3 v3.5.4/go.mod h1:IJHfcCEKxYu1Os13ZdwCwIUTUVGYTSAM3YSwc9/Ac1g= -go.etcd.io/etcd/client/pkg/v3 v3.5.17 h1:XxnDXAWq2pnxqx76ljWwiQ9jylbpC4rvkAeRVOUKKVw= -go.etcd.io/etcd/client/pkg/v3 v3.5.17/go.mod h1:4DqK1TKacp/86nJk4FLQqo6Mn2vvQFBmruW3pP14H/w= +go.etcd.io/etcd/client/pkg/v3 v3.5.21 h1:lPBu71Y7osQmzlflM9OfeIV2JlmpBjqBNlLtcoBqUTc= +go.etcd.io/etcd/client/pkg/v3 v3.5.21/go.mod h1:BgqT/IXPjK9NkeSDjbzwsHySX3yIle2+ndz28nVsjUs= go.etcd.io/etcd/client/v2 v2.305.4/go.mod h1:Ud+VUwIi9/uQHOMA+4ekToJ12lTxlv0zB/+DHwTGEbU= go.etcd.io/etcd/client/v3 v3.5.4/go.mod h1:ZaRkVgBZC+L+dLCjTcF1hRXpgZXQPOvnA/Ak/gq3kiY= -go.etcd.io/etcd/client/v3 v3.5.17 h1:o48sINNeWz5+pjy/Z0+HKpj/xSnBkuVhVvXkjEXbqZY= -go.etcd.io/etcd/client/v3 v3.5.17/go.mod h1:j2d4eXTHWkT2ClBgnnEPm/Wuu7jsqku41v9DZ3OtjQo= +go.etcd.io/etcd/client/v3 v3.5.21 h1:T6b1Ow6fNjOLOtM0xSoKNQt1ASPCLWrF9XMHcH9pEyY= +go.etcd.io/etcd/client/v3 v3.5.21/go.mod h1:mFYy67IOqmbRf/kRUvsHixzo3iG+1OF2W2+jVIQRAnU= go.mongodb.org/mongo-driver v1.14.0 h1:P98w8egYRjYe3XDjxhYJagTokP/H6HzlsnojRgZRd80= go.mongodb.org/mongo-driver v1.14.0/go.mod h1:Vzb0Mk/pa7e6cWw85R4F/endUC3u0U9jGcNU603k65c= go.opencensus.io v0.21.0/go.mod h1:mSImk1erAIZhrmZN+AvHh14ztQfjbGwt4TtuofqLduU= @@ -1756,8 +1760,8 @@ go.opentelemetry.io/collector/consumer/consumertest v0.118.0 h1:8AAS9ejQapP1zqt0 go.opentelemetry.io/collector/consumer/consumertest v0.118.0/go.mod h1:spRM2wyGr4QZzqMHlLmZnqRCxqXN4Wd0piogC4Qb5PQ= go.opentelemetry.io/collector/consumer/xconsumer v0.118.0 h1:guWnzzRqgCInjnYlOQ1BPrimppNGIVvnknAjlIbWXuY= go.opentelemetry.io/collector/consumer/xconsumer v0.118.0/go.mod h1:C5V2d6Ys/Fi6k3tzjBmbdZ9v3J/rZSAMlhx4KVcMIIg= -go.opentelemetry.io/collector/pdata v1.24.0 h1:D6j92eAzmAbQgivNBUnt8r9juOl8ugb+ihYynoFZIEg= -go.opentelemetry.io/collector/pdata v1.24.0/go.mod h1:cf3/W9E/uIvPS4MR26SnMFJhraUCattzzM6qusuONuc= +go.opentelemetry.io/collector/pdata v1.30.0 h1:j3jyq9um436r6WzWySzexP2nLnFdmL5uVBYAlyr9nDM= +go.opentelemetry.io/collector/pdata v1.30.0/go.mod h1:0Bxu1ktuj4wE7PIASNSvd0SdBscQ1PLtYasymJ13/Cs= go.opentelemetry.io/collector/pdata/pprofile v0.118.0 h1:VK/fr65VFOwEhsSGRPj5c3lCv0yIK1Kt0sZxv9WZBb8= go.opentelemetry.io/collector/pdata/pprofile v0.118.0/go.mod h1:eJyP/vBm179EghV3dPSnamGAWQwLyd+4z/3yG54YFoQ= go.opentelemetry.io/collector/pdata/testdata v0.118.0 h1:5N0w1SX9KIRkwvtkrpzQgXy9eGk3vfNG0ds6mhEPMIM= @@ -1780,8 +1784,8 @@ go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp v0.59.0 h1:CV7UdSG go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp v0.59.0/go.mod h1:FRmFuRJfag1IZ2dPkHnEoSFVgTVPUd2qf5Vi69hLb8I= go.opentelemetry.io/contrib/propagators/autoprop v0.54.0 h1:h/O1OcNbqrFilsMKfG6MJWWpx8gzCDfn9D+1W7lU3lE= go.opentelemetry.io/contrib/propagators/autoprop v0.54.0/go.mod h1:VIaPlErTgbng1UhrMA4N6Yy+f94PLA/qRPOCMATdoCs= -go.opentelemetry.io/contrib/propagators/aws v1.33.0 h1:MefPfPIut0IxEiQRK1qVv5AFADBOwizl189+m7QhpFg= -go.opentelemetry.io/contrib/propagators/aws v1.33.0/go.mod h1:VB6xPo12uW/PezOqtA/cY2/DiAGYshnhID606wC9NEY= +go.opentelemetry.io/contrib/propagators/aws v1.35.0 h1:xoXA+5dVwsf5uE5GvSJ3lKiapyMFuIzbEmJwQ0JP+QU= +go.opentelemetry.io/contrib/propagators/aws v1.35.0/go.mod h1:s11Orts/IzEgw9Srw5iRXtk2kM2j3jt/45noUWyf60E= go.opentelemetry.io/contrib/propagators/b3 v1.29.0 h1:hNjyoRsAACnhoOLWupItUjABzeYmX3GTTZLzwJluJlk= go.opentelemetry.io/contrib/propagators/b3 v1.29.0/go.mod h1:E76MTitU1Niwo5NSN+mVxkyLu4h4h7Dp/yh38F2WuIU= go.opentelemetry.io/contrib/propagators/jaeger v1.29.0 h1:+YPiqF5rR6PqHBlmEFLPumbSP0gY0WmCGFayXRcCLvs= @@ -1790,12 +1794,12 @@ go.opentelemetry.io/contrib/propagators/ot v1.29.0 h1:CaJU78FvXrA6ajjp1dOdcABBEj go.opentelemetry.io/contrib/propagators/ot v1.29.0/go.mod h1:Sc0omwLb4eptUhwOAfYXfmPmErHPu2HV6vkeDge/3sY= go.opentelemetry.io/otel v1.35.0 h1:xKWKPxrxB6OtMCbmMY021CqC45J+3Onta9MqjhnusiQ= go.opentelemetry.io/otel v1.35.0/go.mod h1:UEqy8Zp11hpkUrL73gSlELM0DupHoiq72dR+Zqel/+Y= -go.opentelemetry.io/otel/bridge/opentracing v1.33.0 h1:eH88qvKdY7ns7Xu6WlJBQNOzZ3MVvBR6tEl2euaYS9w= -go.opentelemetry.io/otel/bridge/opentracing v1.33.0/go.mod h1:FNai/nhRSn/kHyv+V1zaf/30BU8hO/DXo0MvV0PaUS8= -go.opentelemetry.io/otel/exporters/otlp/otlptrace v1.34.0 h1:OeNbIYk/2C15ckl7glBlOBp5+WlYsOElzTNmiPW/x60= -go.opentelemetry.io/otel/exporters/otlp/otlptrace v1.34.0/go.mod h1:7Bept48yIeqxP2OZ9/AqIpYS94h2or0aB4FypJTc8ZM= -go.opentelemetry.io/otel/exporters/otlp/otlptrace/otlptracegrpc v1.34.0 h1:tgJ0uaNS4c98WRNUEx5U3aDlrDOI5Rs+1Vifcw4DJ8U= -go.opentelemetry.io/otel/exporters/otlp/otlptrace/otlptracegrpc v1.34.0/go.mod h1:U7HYyW0zt/a9x5J1Kjs+r1f/d4ZHnYFclhYY2+YbeoE= +go.opentelemetry.io/otel/bridge/opentracing v1.35.0 h1:qT4jl1fYl0hHuRopNcwS94QosLFhGYcS0HacPUeXmT4= +go.opentelemetry.io/otel/bridge/opentracing v1.35.0/go.mod h1:p5CbIL4v7uQz7mnQD6T/AZc1pPUzwz+2wZ1zrGY9Kgs= +go.opentelemetry.io/otel/exporters/otlp/otlptrace v1.35.0 h1:1fTNlAIJZGWLP5FVu0fikVry1IsiUnXjf7QFvoNN3Xw= +go.opentelemetry.io/otel/exporters/otlp/otlptrace v1.35.0/go.mod h1:zjPK58DtkqQFn+YUMbx0M2XV3QgKU0gS9LeGohREyK4= +go.opentelemetry.io/otel/exporters/otlp/otlptrace/otlptracegrpc v1.35.0 h1:m639+BofXTvcY1q8CGs4ItwQarYtJPOWmVobfM1HpVI= +go.opentelemetry.io/otel/exporters/otlp/otlptrace/otlptracegrpc v1.35.0/go.mod h1:LjReUci/F4BUyv+y4dwnq3h/26iNOeC3wAIqgvTIZVo= go.opentelemetry.io/otel/metric v1.35.0 h1:0znxYu2SNyuMSQT4Y9WDWej0VpcsxkuklLa4/siN90M= go.opentelemetry.io/otel/metric v1.35.0/go.mod h1:nKVFgxBZ2fReX6IlyW28MgZojkoAkJGaE8CpgeAU3oE= go.opentelemetry.io/otel/sdk v1.35.0 h1:iPctf8iprVySXSKJffSS79eOjl9pvxV9ZqOWT0QejKY= @@ -1853,8 +1857,8 @@ golang.org/x/crypto v0.18.0/go.mod h1:R0j02AL6hcrfOiy9T4ZYp/rcWeMxM3L6QYxlOuEG1m golang.org/x/crypto v0.19.0/go.mod h1:Iy9bg/ha4yyC70EfRS8jz+B6ybOBKMaSxLj6P6oBDfU= golang.org/x/crypto v0.21.0/go.mod h1:0BP7YvVV9gBbVKyeTG0Gyn+gZm94bibOW5BjDEYAOMs= golang.org/x/crypto v0.23.0/go.mod h1:CKFgDieR+mRhux2Lsu27y0fO304Db0wZe70UKqHu0v8= -golang.org/x/crypto v0.36.0 h1:AnAEvhDddvBdpY+uR+MyHmuZzzNqXSe/GvuDeob5L34= -golang.org/x/crypto v0.36.0/go.mod h1:Y4J0ReaxCR1IMaabaSMugxJES1EpwhBHhv2bDHklZvc= +golang.org/x/crypto v0.37.0 h1:kJNSjF/Xp7kU0iB2Z+9viTPMW4EqqsrywMXLJOOsXSE= +golang.org/x/crypto v0.37.0/go.mod h1:vg+k43peMZ0pUMhYmVAWysMK35e6ioLh3wB8ZCAfbVc= golang.org/x/exp v0.0.0-20180321215751-8460e604b9de/go.mod h1:CJ0aWSM057203Lf6IL+f9T1iT9GByDxfZKAQTCR3kQA= golang.org/x/exp v0.0.0-20180807140117-3d87b88a115f/go.mod h1:CJ0aWSM057203Lf6IL+f9T1iT9GByDxfZKAQTCR3kQA= golang.org/x/exp v0.0.0-20190121172915-509febef88a4/go.mod h1:CJ0aWSM057203Lf6IL+f9T1iT9GByDxfZKAQTCR3kQA= @@ -1870,8 +1874,8 @@ golang.org/x/exp v0.0.0-20200119233911-0405dc783f0a/go.mod h1:2RIsYlXP63K8oxa1u0 golang.org/x/exp v0.0.0-20200207192155-f17229e696bd/go.mod h1:J/WKrq2StrnmMY6+EHIKF9dgMWnmCNThgcyBT1FY9mM= golang.org/x/exp v0.0.0-20200224162631-6cc2880d07d6/go.mod h1:3jZMyOhIsHpP37uCMkUooju7aAi5cS1Q23tOzKc+0MU= golang.org/x/exp v0.0.0-20220827204233-334a2380cb91/go.mod h1:cyybsKvd6eL0RnXn6p/Grxp8F5bW7iYuBgsNCOHpMYE= -golang.org/x/exp v0.0.0-20240613232115-7f521ea00fb8 h1:yixxcjnhBmY0nkL253HFVIm0JsFHwrHdT3Yh6szTnfY= -golang.org/x/exp v0.0.0-20240613232115-7f521ea00fb8/go.mod h1:jj3sYF3dwk5D+ghuXyeI3r5MFf+NT2An6/9dOA95KSI= +golang.org/x/exp v0.0.0-20250106191152-7588d65b2ba8 h1:yqrTHse8TCMW1M1ZCP+VAR/l0kKxwaAIqN/il7x4voA= +golang.org/x/exp v0.0.0-20250106191152-7588d65b2ba8/go.mod h1:tujkw807nyEEAamNbDrEGzRav+ilXA7PCRAd6xsmwiU= golang.org/x/image v0.0.0-20180708004352-c73c2afc3b81/go.mod h1:ux5Hcp/YLpHSI86hEcLt0YII63i6oz57MZXIpbrjZUs= golang.org/x/image v0.0.0-20190227222117-0694c2d4d067/go.mod h1:kZ7UVZpmo3dzQBMxlp+ypCbDeSB+sBbTgSJuh5dn5js= golang.org/x/image v0.0.0-20190802002840-cff245a6509b/go.mod h1:FeLwcggjj3mMvU+oOTbSwawSJRM1uh48EjtB4UJZlP0= @@ -1989,8 +1993,8 @@ golang.org/x/net v0.20.0/go.mod h1:z8BVo6PvndSri0LbOE3hAn0apkU+1YvI6E70E9jsnvY= golang.org/x/net v0.21.0/go.mod h1:bIjVDfnllIU7BJ2DNgfnXvpSvtn8VRwhlsaeUTyUS44= golang.org/x/net v0.22.0/go.mod h1:JKghWKKOSdJwpW2GEx0Ja7fmaKnMsbu+MWVZTokSYmg= golang.org/x/net v0.25.0/go.mod h1:JkAGAh7GEvH74S6FOH42FLoXpXbE/aqXSrIQjXgsiwM= -golang.org/x/net v0.38.0 h1:vRMAPTMaeGqVhG5QyLJHqNDwecKTomGeqbnfZyKlBI8= -golang.org/x/net v0.38.0/go.mod h1:ivrbrMbzFq5J41QOQh0siUuly180yBYtLp+CKbEaFx8= +golang.org/x/net v0.39.0 h1:ZCu7HMWDxpXpaiKdhzIfaltL9Lp31x/3fCP11bc6/fY= +golang.org/x/net v0.39.0/go.mod h1:X7NRbYVEA+ewNkCNyJ513WmMdQ3BineSwVtN2zD/d+E= golang.org/x/oauth2 v0.0.0-20180821212333-d2e6202438be/go.mod h1:N/0e6XlmueqKjAGxoOufVs8QHGRruUQn6yWY3a++T0U= golang.org/x/oauth2 v0.0.0-20190226205417-e64efc72b421/go.mod h1:gOpvHmFTYa4IltrdGE7lF6nIHvwfUNPOp7c8zoXwtLw= golang.org/x/oauth2 v0.0.0-20190604053449-0f29369cfe45/go.mod h1:gOpvHmFTYa4IltrdGE7lF6nIHvwfUNPOp7c8zoXwtLw= @@ -2022,8 +2026,8 @@ golang.org/x/oauth2 v0.6.0/go.mod h1:ycmewcwgD4Rpr3eZJLSB4Kyyljb3qDh40vJ8STE5HKw golang.org/x/oauth2 v0.7.0/go.mod h1:hPLQkd9LyjfXTiRohC/41GhcFqxisoUQ99sCUOHO9x4= golang.org/x/oauth2 v0.8.0/go.mod h1:yr7u4HXZRm1R1kBWqr/xKNqewf0plRYoB7sla+BCIXE= golang.org/x/oauth2 v0.20.0/go.mod h1:XYTD2NtWslqkgxebSiOHnXEap4TF09sJSc7H1sXbhtI= -golang.org/x/oauth2 v0.25.0 h1:CY4y7XT9v0cRI9oupztF8AgiIu99L/ksR/Xp/6jrZ70= -golang.org/x/oauth2 v0.25.0/go.mod h1:XYTD2NtWslqkgxebSiOHnXEap4TF09sJSc7H1sXbhtI= +golang.org/x/oauth2 v0.26.0 h1:afQXWNNaeC4nvZ0Ed9XvCCzXM6UHJG7iCg0W4fPqSBE= +golang.org/x/oauth2 v0.26.0/go.mod h1:XYTD2NtWslqkgxebSiOHnXEap4TF09sJSc7H1sXbhtI= golang.org/x/sync v0.0.0-20181108010431-42b317875d0f/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM= golang.org/x/sync v0.0.0-20181221193216-37e7f081c4d4/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM= golang.org/x/sync v0.0.0-20190227155943-e225da77a7e6/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM= @@ -2043,8 +2047,8 @@ golang.org/x/sync v0.1.0/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM= golang.org/x/sync v0.2.0/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM= golang.org/x/sync v0.3.0/go.mod h1:FU7BRWz2tNW+3quACPkgCx/L+uEAv1htQ0V83Z9Rj+Y= golang.org/x/sync v0.7.0/go.mod h1:Czt+wKu1gCyEFDUtn0jG5QVvpJ6rzVqr5aXyt9drQfk= -golang.org/x/sync v0.12.0 h1:MHc5BpPuC30uJk597Ri8TV3CNZcTLu6B6z4lJy+g6Jw= -golang.org/x/sync v0.12.0/go.mod h1:1dzgHSNfp02xaA81J2MS99Qcpr2w7fw1gpm99rleRqA= +golang.org/x/sync v0.13.0 h1:AauUjRAJ9OSnvULf/ARrrVywoJDy0YS2AwQ98I37610= +golang.org/x/sync v0.13.0/go.mod h1:1dzgHSNfp02xaA81J2MS99Qcpr2w7fw1gpm99rleRqA= golang.org/x/sys v0.0.0-20180823144017-11551d06cbcc/go.mod h1:STP8DvDyc/dI5b8T5hshtkjS+E42TnysNCUPdjciGhY= golang.org/x/sys v0.0.0-20180905080454-ebe1bf3edb33/go.mod h1:STP8DvDyc/dI5b8T5hshtkjS+E42TnysNCUPdjciGhY= golang.org/x/sys v0.0.0-20181116152217-5ac8a444bdc5/go.mod h1:STP8DvDyc/dI5b8T5hshtkjS+E42TnysNCUPdjciGhY= @@ -2151,8 +2155,8 @@ golang.org/x/sys v0.16.0/go.mod h1:/VUhepiaJMQUp4+oa/7Zr1D23ma6VTLIYjOOTFZPUcA= golang.org/x/sys v0.17.0/go.mod h1:/VUhepiaJMQUp4+oa/7Zr1D23ma6VTLIYjOOTFZPUcA= golang.org/x/sys v0.18.0/go.mod h1:/VUhepiaJMQUp4+oa/7Zr1D23ma6VTLIYjOOTFZPUcA= golang.org/x/sys v0.20.0/go.mod h1:/VUhepiaJMQUp4+oa/7Zr1D23ma6VTLIYjOOTFZPUcA= -golang.org/x/sys v0.31.0 h1:ioabZlmFYtWhL+TRYpcnNlLwhyxaM9kWTDEmfnprqik= -golang.org/x/sys v0.31.0/go.mod h1:BJP2sWEmIv4KK5OTEluFJCKSidICx8ciO85XgH3Ak8k= +golang.org/x/sys v0.32.0 h1:s77OFDvIQeibCmezSnk/q6iAfkdiQaJi4VzroCFrN20= +golang.org/x/sys v0.32.0/go.mod h1:BJP2sWEmIv4KK5OTEluFJCKSidICx8ciO85XgH3Ak8k= golang.org/x/term v0.0.0-20201126162022-7de9c90e9dd1/go.mod h1:bj7SfCRtBDWHUb9snDiAeCFNEtKQo2Wmx5Cou7ajbmo= golang.org/x/term v0.0.0-20210927222741-03fcf44c2211/go.mod h1:jbD1KX2456YbFQfuXm/mYQcufACuNUgVhRMnK/tPxf8= golang.org/x/term v0.1.0/go.mod h1:jbD1KX2456YbFQfuXm/mYQcufACuNUgVhRMnK/tPxf8= @@ -2169,8 +2173,8 @@ golang.org/x/term v0.16.0/go.mod h1:yn7UURbUtPyrVJPGPq404EukNFxcm/foM+bV/bfcDsY= golang.org/x/term v0.17.0/go.mod h1:lLRBjIVuehSbZlaOtGMbcMncT+aqLLLmKrsjNrUguwk= golang.org/x/term v0.18.0/go.mod h1:ILwASektA3OnRv7amZ1xhE/KTR+u50pbXfZ03+6Nx58= golang.org/x/term v0.20.0/go.mod h1:8UkIAJTvZgivsXaD6/pH6U9ecQzZ45awqEOzuCvwpFY= -golang.org/x/term v0.30.0 h1:PQ39fJZ+mfadBm0y5WlL4vlM7Sx1Hgf13sMIY2+QS9Y= -golang.org/x/term v0.30.0/go.mod h1:NYYFdzHoI5wRh/h5tDMdMqCqPJZEuNqVR5xJLd/n67g= +golang.org/x/term v0.31.0 h1:erwDkOK1Msy6offm1mOgvspSkslFnIGsFnxOKoufg3o= +golang.org/x/term v0.31.0/go.mod h1:R4BeIy7D95HzImkxGkTW1UQTtP54tio2RyHz7PwK0aw= golang.org/x/text v0.0.0-20170915032832-14c0d48ead0c/go.mod h1:NqM8EUOU14njkJ3fqMW+pc6Ldnwhi/IjpwHt7yyuwOQ= golang.org/x/text v0.3.0/go.mod h1:NqM8EUOU14njkJ3fqMW+pc6Ldnwhi/IjpwHt7yyuwOQ= golang.org/x/text v0.3.1-0.20180807135948-17ff2d5776d2/go.mod h1:NqM8EUOU14njkJ3fqMW+pc6Ldnwhi/IjpwHt7yyuwOQ= @@ -2190,16 +2194,16 @@ golang.org/x/text v0.10.0/go.mod h1:TvPlkZtksWOMsz7fbANvkp4WM8x/WCo/om8BMLbz+aE= golang.org/x/text v0.13.0/go.mod h1:TvPlkZtksWOMsz7fbANvkp4WM8x/WCo/om8BMLbz+aE= golang.org/x/text v0.14.0/go.mod h1:18ZOQIKpY8NJVqYksKHtTdi31H5itFRjB5/qKTNYzSU= golang.org/x/text v0.15.0/go.mod h1:18ZOQIKpY8NJVqYksKHtTdi31H5itFRjB5/qKTNYzSU= -golang.org/x/text v0.23.0 h1:D71I7dUrlY+VX0gQShAThNGHFxZ13dGLBHQLVl1mJlY= -golang.org/x/text v0.23.0/go.mod h1:/BLNzu4aZCJ1+kcD0DNRotWKage4q2rGVAg4o22unh4= +golang.org/x/text v0.24.0 h1:dd5Bzh4yt5KYA8f9CJHCP4FB4D51c2c6JvN37xJJkJ0= +golang.org/x/text v0.24.0/go.mod h1:L8rBsPeo2pSS+xqN0d5u2ikmjtmoJbDBT1b7nHvFCdU= golang.org/x/time v0.0.0-20181108054448-85acf8d2951c/go.mod h1:tRJNPiyCQ0inRvYxbN9jk5I+vvW/OXSQhTDSoE431IQ= golang.org/x/time v0.0.0-20190308202827-9d24e82272b4/go.mod h1:tRJNPiyCQ0inRvYxbN9jk5I+vvW/OXSQhTDSoE431IQ= golang.org/x/time v0.0.0-20191024005414-555d28b269f0/go.mod h1:tRJNPiyCQ0inRvYxbN9jk5I+vvW/OXSQhTDSoE431IQ= golang.org/x/time v0.0.0-20220922220347-f3bd1da661af/go.mod h1:tRJNPiyCQ0inRvYxbN9jk5I+vvW/OXSQhTDSoE431IQ= golang.org/x/time v0.1.0/go.mod h1:tRJNPiyCQ0inRvYxbN9jk5I+vvW/OXSQhTDSoE431IQ= golang.org/x/time v0.3.0/go.mod h1:tRJNPiyCQ0inRvYxbN9jk5I+vvW/OXSQhTDSoE431IQ= -golang.org/x/time v0.9.0 h1:EsRrnYcQiGH+5FfbgvV4AP7qEZstoyrHB0DzarOQ4ZY= -golang.org/x/time v0.9.0/go.mod h1:3BpzKBy/shNhVucY/MWOyx10tF3SFh9QdLuxbVysPQM= +golang.org/x/time v0.11.0 h1:/bpjEDfN9tkoN/ryeYHnv5hcMlc8ncjMcM4XBk5NWV0= +golang.org/x/time v0.11.0/go.mod h1:CDIdPxbZBQxdj6cxyCIdrNogrJKMJ7pr37NYpMcMDSg= golang.org/x/tools v0.0.0-20180525024113-a5b4c53f6e8b/go.mod h1:n7NCudcB/nEzxVGmLbDWY5pfWTLqBcC2KZ6jyYvM4mQ= golang.org/x/tools v0.0.0-20180917221912-90fa682c2a6e/go.mod h1:n7NCudcB/nEzxVGmLbDWY5pfWTLqBcC2KZ6jyYvM4mQ= golang.org/x/tools v0.0.0-20181030221726-6c7e314b6563/go.mod h1:n7NCudcB/nEzxVGmLbDWY5pfWTLqBcC2KZ6jyYvM4mQ= @@ -2517,8 +2521,8 @@ google.golang.org/genproto/googleapis/api v0.0.0-20230711160842-782d3b101e98/go. google.golang.org/genproto/googleapis/api v0.0.0-20230726155614-23370e0ffb3e/go.mod h1:rsr7RhLuwsDKL7RmgDDCUc6yaGr1iqceVb5Wv6f6YvQ= google.golang.org/genproto/googleapis/api v0.0.0-20230822172742-b8732ec3820d/go.mod h1:KjSP20unUpOx5kyQUFa7k4OJg0qeJ7DEZflGDu2p6Bk= google.golang.org/genproto/googleapis/api v0.0.0-20240528184218-531527333157/go.mod h1:99sLkeliLXfdj2J75X3Ho+rrVCaJze0uwN7zDDkjPVU= -google.golang.org/genproto/googleapis/api v0.0.0-20250115164207-1a7da9e5054f h1:gap6+3Gk41EItBuyi4XX/bp4oqJ3UwuIMl25yGinuAA= -google.golang.org/genproto/googleapis/api v0.0.0-20250115164207-1a7da9e5054f/go.mod h1:Ic02D47M+zbarjYYUlK57y316f2MoN0gjAwI3f2S95o= +google.golang.org/genproto/googleapis/api v0.0.0-20250218202821-56aae31c358a h1:nwKuGPlUAt+aR+pcrkfFRrTU1BVrSmYyYMxYbUIVHr0= +google.golang.org/genproto/googleapis/api v0.0.0-20250218202821-56aae31c358a/go.mod h1:3kWAYMk1I75K4vykHtKt2ycnOgpA6974V7bREqbsenU= google.golang.org/genproto/googleapis/bytestream v0.0.0-20230530153820-e85fd2cbaebc/go.mod h1:ylj+BE99M198VPbBh6A8d9n3w8fChvyLK3wwBOjXBFA= google.golang.org/genproto/googleapis/rpc v0.0.0-20230525234015-3fc162c6f38a/go.mod h1:xURIpW9ES5+/GZhnV6beoEtxQrnkRGIfP5VQG2tCBLc= google.golang.org/genproto/googleapis/rpc v0.0.0-20230525234030-28d5490b6b19/go.mod h1:66JfowdXAEgad5O9NnYcsNPLCPZJD++2L9X0PCMODrA= @@ -2532,8 +2536,8 @@ google.golang.org/genproto/googleapis/rpc v0.0.0-20230803162519-f966b187b2e5/go. google.golang.org/genproto/googleapis/rpc v0.0.0-20240318140521-94a12d6c2237/go.mod h1:WtryC6hu0hhx87FDGxWCDptyssuo68sk10vYjF+T9fY= google.golang.org/genproto/googleapis/rpc v0.0.0-20240521202816-d264139d666e/go.mod h1:EfXuqaE1J41VCDicxHzUDm+8rk+7ZdXzHV0IhO/I6s0= google.golang.org/genproto/googleapis/rpc v0.0.0-20240528184218-531527333157/go.mod h1:EfXuqaE1J41VCDicxHzUDm+8rk+7ZdXzHV0IhO/I6s0= -google.golang.org/genproto/googleapis/rpc v0.0.0-20250115164207-1a7da9e5054f h1:OxYkA3wjPsZyBylwymxSHa7ViiW1Sml4ToBrncvFehI= -google.golang.org/genproto/googleapis/rpc v0.0.0-20250115164207-1a7da9e5054f/go.mod h1:+2Yz8+CLJbIfL9z73EW45avw8Lmge3xVElCP9zEKi50= +google.golang.org/genproto/googleapis/rpc v0.0.0-20250218202821-56aae31c358a h1:51aaUVRocpvUOSQKM6Q7VuoaktNIaMCLuhZB6DKksq4= +google.golang.org/genproto/googleapis/rpc v0.0.0-20250218202821-56aae31c358a/go.mod h1:uRxBH1mhmO8PGhU89cMcHaXKZqO+OfakD8QQO0oYwlQ= google.golang.org/grpc v1.65.0 h1:bs/cUb4lp1G5iImFFd3u5ixQzweKizoZJAwBNLR42lc= google.golang.org/grpc v1.65.0/go.mod h1:WgYC2ypjlB0EiQi6wdKixMqukr6lBc0Vo+oOgjrM5ZQ= google.golang.org/grpc/cmd/protoc-gen-go-grpc v1.1.0/go.mod h1:6Kw0yEErY5E/yWrBtf03jp27GLLJujG4z/JK95pnjjw= @@ -2558,8 +2562,8 @@ google.golang.org/protobuf v1.31.0/go.mod h1:HV8QOd/L58Z+nl8r43ehVNZIU/HEI6OcFqw google.golang.org/protobuf v1.32.0/go.mod h1:c6P6GXX6sHbq/GpV6MGZEdwhWPcYBgnhAHhKbcUYpos= google.golang.org/protobuf v1.33.0/go.mod h1:c6P6GXX6sHbq/GpV6MGZEdwhWPcYBgnhAHhKbcUYpos= google.golang.org/protobuf v1.34.1/go.mod h1:c6P6GXX6sHbq/GpV6MGZEdwhWPcYBgnhAHhKbcUYpos= -google.golang.org/protobuf v1.36.4 h1:6A3ZDJHn/eNqc1i+IdefRzy/9PokBTPvcqMySR7NNIM= -google.golang.org/protobuf v1.36.4/go.mod h1:9fA7Ob0pmnwhb644+1+CVWFRbNajQ6iRojtC/QF5bRE= +google.golang.org/protobuf v1.36.6 h1:z1NpPI8ku2WgiWnf+t9wTPsn6eP1L7ksHUlkfLvd9xY= +google.golang.org/protobuf v1.36.6/go.mod h1:jduwjTPXsFjZGTmRluh+L6NjiWu7pchiJ2/5YcXBHnY= gopkg.in/check.v1 v0.0.0-20161208181325-20d25e280405/go.mod h1:Co6ibVJAznAaIkqp8huTwlJQCZ016jof/cbN4VW5Yz0= gopkg.in/check.v1 v1.0.0-20180628173108-788fd7840127/go.mod h1:Co6ibVJAznAaIkqp8huTwlJQCZ016jof/cbN4VW5Yz0= gopkg.in/check.v1 v1.0.0-20190902080502-41f04d3bba15/go.mod h1:Co6ibVJAznAaIkqp8huTwlJQCZ016jof/cbN4VW5Yz0= diff --git a/vendor/github.com/go-openapi/swag/.golangci.yml b/vendor/github.com/go-openapi/swag/.golangci.yml index 80e2be0042f..d2fafb8a2bb 100644 --- a/vendor/github.com/go-openapi/swag/.golangci.yml +++ b/vendor/github.com/go-openapi/swag/.golangci.yml @@ -1,22 +1,17 @@ linters-settings: - govet: - check-shadowing: true - golint: - min-confidence: 0 gocyclo: min-complexity: 45 - maligned: - suggest-new: true dupl: threshold: 200 goconst: - min-len: 3 + min-len: 2 min-occurrences: 3 linters: enable-all: true disable: - - maligned + - recvcheck + - unparam - lll - gochecknoinits - gochecknoglobals @@ -28,9 +23,6 @@ linters: - wrapcheck - testpackage - nlreturn - - gomnd - - exhaustivestruct - - goerr113 - errorlint - nestif - godot @@ -38,7 +30,6 @@ linters: - paralleltest - tparallel - thelper - - ifshort - exhaustruct - varnamelen - gci @@ -51,10 +42,15 @@ linters: - forcetypeassert - cyclop # deprecated linters - - deadcode - - interfacer - - scopelint - - varcheck - - structcheck - - golint - - nosnakecase + #- deadcode + #- interfacer + #- scopelint + #- varcheck + #- structcheck + #- golint + #- nosnakecase + #- maligned + #- goerr113 + #- ifshort + #- gomnd + #- exhaustivestruct diff --git a/vendor/github.com/go-openapi/swag/errors.go b/vendor/github.com/go-openapi/swag/errors.go new file mode 100644 index 00000000000..6c67fbf92e3 --- /dev/null +++ b/vendor/github.com/go-openapi/swag/errors.go @@ -0,0 +1,15 @@ +package swag + +type swagError string + +const ( + // ErrYAML is an error raised by YAML utilities + ErrYAML swagError = "yaml error" + + // ErrLoader is an error raised by the file loader utility + ErrLoader swagError = "loader error" +) + +func (e swagError) Error() string { + return string(e) +} diff --git a/vendor/github.com/go-openapi/swag/json.go b/vendor/github.com/go-openapi/swag/json.go index 7e9902ca314..c7caa9908fe 100644 --- a/vendor/github.com/go-openapi/swag/json.go +++ b/vendor/github.com/go-openapi/swag/json.go @@ -126,7 +126,8 @@ func ConcatJSON(blobs ...[]byte) []byte { continue // don't know how to concatenate non container objects } - if len(b) < 3 { // yep empty but also the last one, so closing this thing + const minLengthIfNotEmpty = 3 + if len(b) < minLengthIfNotEmpty { // yep empty but also the last one, so closing this thing if i == last && a > 0 { if err := buf.WriteByte(closing); err != nil { log.Println(err) diff --git a/vendor/github.com/go-openapi/swag/loading.go b/vendor/github.com/go-openapi/swag/loading.go index 783442fddf6..658a24b789b 100644 --- a/vendor/github.com/go-openapi/swag/loading.go +++ b/vendor/github.com/go-openapi/swag/loading.go @@ -168,7 +168,7 @@ func loadHTTPBytes(timeout time.Duration) func(path string) ([]byte, error) { } if resp.StatusCode != http.StatusOK { - return nil, fmt.Errorf("could not access document at %q [%s] ", path, resp.Status) + return nil, fmt.Errorf("could not access document at %q [%s]: %w", path, resp.Status, ErrLoader) } return io.ReadAll(resp.Body) diff --git a/vendor/github.com/go-openapi/swag/yaml.go b/vendor/github.com/go-openapi/swag/yaml.go index f59e0259320..575346539ac 100644 --- a/vendor/github.com/go-openapi/swag/yaml.go +++ b/vendor/github.com/go-openapi/swag/yaml.go @@ -16,7 +16,6 @@ package swag import ( "encoding/json" - "errors" "fmt" "path/filepath" "reflect" @@ -51,7 +50,7 @@ func BytesToYAMLDoc(data []byte) (interface{}, error) { return nil, err } if document.Kind != yaml.DocumentNode || len(document.Content) != 1 || document.Content[0].Kind != yaml.MappingNode { - return nil, errors.New("only YAML documents that are objects are supported") + return nil, fmt.Errorf("only YAML documents that are objects are supported: %w", ErrYAML) } return &document, nil } @@ -69,31 +68,32 @@ func yamlNode(root *yaml.Node) (interface{}, error) { case yaml.AliasNode: return yamlNode(root.Alias) default: - return nil, fmt.Errorf("unsupported YAML node type: %v", root.Kind) + return nil, fmt.Errorf("unsupported YAML node type: %v: %w", root.Kind, ErrYAML) } } func yamlDocument(node *yaml.Node) (interface{}, error) { if len(node.Content) != 1 { - return nil, fmt.Errorf("unexpected YAML Document node content length: %d", len(node.Content)) + return nil, fmt.Errorf("unexpected YAML Document node content length: %d: %w", len(node.Content), ErrYAML) } return yamlNode(node.Content[0]) } func yamlMapping(node *yaml.Node) (interface{}, error) { - m := make(JSONMapSlice, len(node.Content)/2) + const sensibleAllocDivider = 2 + m := make(JSONMapSlice, len(node.Content)/sensibleAllocDivider) var j int for i := 0; i < len(node.Content); i += 2 { var nmi JSONMapItem k, err := yamlStringScalarC(node.Content[i]) if err != nil { - return nil, fmt.Errorf("unable to decode YAML map key: %w", err) + return nil, fmt.Errorf("unable to decode YAML map key: %w: %w", err, ErrYAML) } nmi.Key = k v, err := yamlNode(node.Content[i+1]) if err != nil { - return nil, fmt.Errorf("unable to process YAML map value for key %q: %w", k, err) + return nil, fmt.Errorf("unable to process YAML map value for key %q: %w: %w", k, err, ErrYAML) } nmi.Value = v m[j] = nmi @@ -109,7 +109,7 @@ func yamlSequence(node *yaml.Node) (interface{}, error) { v, err := yamlNode(node.Content[i]) if err != nil { - return nil, fmt.Errorf("unable to decode YAML sequence value: %w", err) + return nil, fmt.Errorf("unable to decode YAML sequence value: %w: %w", err, ErrYAML) } s = append(s, v) } @@ -132,19 +132,19 @@ func yamlScalar(node *yaml.Node) (interface{}, error) { case yamlBoolScalar: b, err := strconv.ParseBool(node.Value) if err != nil { - return nil, fmt.Errorf("unable to process scalar node. Got %q. Expecting bool content: %w", node.Value, err) + return nil, fmt.Errorf("unable to process scalar node. Got %q. Expecting bool content: %w: %w", node.Value, err, ErrYAML) } return b, nil case yamlIntScalar: i, err := strconv.ParseInt(node.Value, 10, 64) if err != nil { - return nil, fmt.Errorf("unable to process scalar node. Got %q. Expecting integer content: %w", node.Value, err) + return nil, fmt.Errorf("unable to process scalar node. Got %q. Expecting integer content: %w: %w", node.Value, err, ErrYAML) } return i, nil case yamlFloatScalar: f, err := strconv.ParseFloat(node.Value, 64) if err != nil { - return nil, fmt.Errorf("unable to process scalar node. Got %q. Expecting float content: %w", node.Value, err) + return nil, fmt.Errorf("unable to process scalar node. Got %q. Expecting float content: %w: %w", node.Value, err, ErrYAML) } return f, nil case yamlTimestamp: @@ -152,19 +152,19 @@ func yamlScalar(node *yaml.Node) (interface{}, error) { case yamlNull: return nil, nil //nolint:nilnil default: - return nil, fmt.Errorf("YAML tag %q is not supported", node.LongTag()) + return nil, fmt.Errorf("YAML tag %q is not supported: %w", node.LongTag(), ErrYAML) } } func yamlStringScalarC(node *yaml.Node) (string, error) { if node.Kind != yaml.ScalarNode { - return "", fmt.Errorf("expecting a string scalar but got %q", node.Kind) + return "", fmt.Errorf("expecting a string scalar but got %q: %w", node.Kind, ErrYAML) } switch node.LongTag() { case yamlStringScalar, yamlIntScalar, yamlFloatScalar: return node.Value, nil default: - return "", fmt.Errorf("YAML tag %q is not supported as map key", node.LongTag()) + return "", fmt.Errorf("YAML tag %q is not supported as map key: %w", node.LongTag(), ErrYAML) } } @@ -349,7 +349,7 @@ func json2yaml(item interface{}) (*yaml.Node, error) { Value: strconv.FormatBool(val), }, nil default: - return nil, fmt.Errorf("unhandled type: %T", val) + return nil, fmt.Errorf("unhandled type: %T: %w", val, ErrYAML) } } @@ -416,7 +416,7 @@ func transformData(input interface{}) (out interface{}, err error) { case int64: return strconv.FormatInt(k, 10), nil default: - return "", fmt.Errorf("unexpected map key type, got: %T", k) + return "", fmt.Errorf("unexpected map key type, got: %T: %w", k, ErrYAML) } } diff --git a/vendor/github.com/goccy/go-json/internal/decoder/compile.go b/vendor/github.com/goccy/go-json/internal/decoder/compile.go index fab6437647b..8ad50936c0c 100644 --- a/vendor/github.com/goccy/go-json/internal/decoder/compile.go +++ b/vendor/github.com/goccy/go-json/internal/decoder/compile.go @@ -5,6 +5,7 @@ import ( "fmt" "reflect" "strings" + "sync" "sync/atomic" "unicode" "unsafe" @@ -17,22 +18,27 @@ var ( typeAddr *runtime.TypeAddr cachedDecoderMap unsafe.Pointer // map[uintptr]decoder cachedDecoder []Decoder + initOnce sync.Once ) -func init() { - typeAddr = runtime.AnalyzeTypeAddr() - if typeAddr == nil { - typeAddr = &runtime.TypeAddr{} - } - cachedDecoder = make([]Decoder, typeAddr.AddrRange>>typeAddr.AddrShift+1) +func initDecoder() { + initOnce.Do(func() { + typeAddr = runtime.AnalyzeTypeAddr() + if typeAddr == nil { + typeAddr = &runtime.TypeAddr{} + } + cachedDecoder = make([]Decoder, typeAddr.AddrRange>>typeAddr.AddrShift+1) + }) } func loadDecoderMap() map[uintptr]Decoder { + initDecoder() p := atomic.LoadPointer(&cachedDecoderMap) return *(*map[uintptr]Decoder)(unsafe.Pointer(&p)) } func storeDecoder(typ uintptr, dec Decoder, m map[uintptr]Decoder) { + initDecoder() newDecoderMap := make(map[uintptr]Decoder, len(m)+1) newDecoderMap[typ] = dec diff --git a/vendor/github.com/goccy/go-json/internal/decoder/compile_norace.go b/vendor/github.com/goccy/go-json/internal/decoder/compile_norace.go index eb7e2b1345d..025ca85b5e2 100644 --- a/vendor/github.com/goccy/go-json/internal/decoder/compile_norace.go +++ b/vendor/github.com/goccy/go-json/internal/decoder/compile_norace.go @@ -10,6 +10,7 @@ import ( ) func CompileToGetDecoder(typ *runtime.Type) (Decoder, error) { + initDecoder() typeptr := uintptr(unsafe.Pointer(typ)) if typeptr > typeAddr.MaxTypeAddr { return compileToGetDecoderSlowPath(typeptr, typ) diff --git a/vendor/github.com/goccy/go-json/internal/decoder/compile_race.go b/vendor/github.com/goccy/go-json/internal/decoder/compile_race.go index 49cdda4a172..023b817c368 100644 --- a/vendor/github.com/goccy/go-json/internal/decoder/compile_race.go +++ b/vendor/github.com/goccy/go-json/internal/decoder/compile_race.go @@ -13,6 +13,7 @@ import ( var decMu sync.RWMutex func CompileToGetDecoder(typ *runtime.Type) (Decoder, error) { + initDecoder() typeptr := uintptr(unsafe.Pointer(typ)) if typeptr > typeAddr.MaxTypeAddr { return compileToGetDecoderSlowPath(typeptr, typ) diff --git a/vendor/github.com/goccy/go-json/internal/encoder/compiler.go b/vendor/github.com/goccy/go-json/internal/encoder/compiler.go index 37b7aa38e26..b107636890a 100644 --- a/vendor/github.com/goccy/go-json/internal/encoder/compiler.go +++ b/vendor/github.com/goccy/go-json/internal/encoder/compiler.go @@ -5,6 +5,7 @@ import ( "encoding" "encoding/json" "reflect" + "sync" "sync/atomic" "unsafe" @@ -24,14 +25,17 @@ var ( cachedOpcodeSets []*OpcodeSet cachedOpcodeMap unsafe.Pointer // map[uintptr]*OpcodeSet typeAddr *runtime.TypeAddr + initEncoderOnce sync.Once ) -func init() { - typeAddr = runtime.AnalyzeTypeAddr() - if typeAddr == nil { - typeAddr = &runtime.TypeAddr{} - } - cachedOpcodeSets = make([]*OpcodeSet, typeAddr.AddrRange>>typeAddr.AddrShift+1) +func initEncoder() { + initEncoderOnce.Do(func() { + typeAddr = runtime.AnalyzeTypeAddr() + if typeAddr == nil { + typeAddr = &runtime.TypeAddr{} + } + cachedOpcodeSets = make([]*OpcodeSet, typeAddr.AddrRange>>typeAddr.AddrShift+1) + }) } func loadOpcodeMap() map[uintptr]*OpcodeSet { diff --git a/vendor/github.com/goccy/go-json/internal/encoder/compiler_norace.go b/vendor/github.com/goccy/go-json/internal/encoder/compiler_norace.go index 20c93cbf709..b6f45a49b0e 100644 --- a/vendor/github.com/goccy/go-json/internal/encoder/compiler_norace.go +++ b/vendor/github.com/goccy/go-json/internal/encoder/compiler_norace.go @@ -4,6 +4,7 @@ package encoder func CompileToGetCodeSet(ctx *RuntimeContext, typeptr uintptr) (*OpcodeSet, error) { + initEncoder() if typeptr > typeAddr.MaxTypeAddr || typeptr < typeAddr.BaseTypeAddr { codeSet, err := compileToGetCodeSetSlowPath(typeptr) if err != nil { diff --git a/vendor/github.com/goccy/go-json/internal/encoder/compiler_race.go b/vendor/github.com/goccy/go-json/internal/encoder/compiler_race.go index 13ba23fdff8..47b482f7fb6 100644 --- a/vendor/github.com/goccy/go-json/internal/encoder/compiler_race.go +++ b/vendor/github.com/goccy/go-json/internal/encoder/compiler_race.go @@ -10,6 +10,7 @@ import ( var setsMu sync.RWMutex func CompileToGetCodeSet(ctx *RuntimeContext, typeptr uintptr) (*OpcodeSet, error) { + initEncoder() if typeptr > typeAddr.MaxTypeAddr || typeptr < typeAddr.BaseTypeAddr { codeSet, err := compileToGetCodeSetSlowPath(typeptr) if err != nil { diff --git a/vendor/github.com/goccy/go-json/internal/encoder/encoder.go b/vendor/github.com/goccy/go-json/internal/encoder/encoder.go index 14eb6a0d643..b436f5b21ff 100644 --- a/vendor/github.com/goccy/go-json/internal/encoder/encoder.go +++ b/vendor/github.com/goccy/go-json/internal/encoder/encoder.go @@ -406,6 +406,11 @@ func AppendMarshalJSON(ctx *RuntimeContext, code *Opcode, b []byte, v interface{ rv = newV } } + + if rv.Kind() == reflect.Ptr && rv.IsNil() { + return AppendNull(ctx, b), nil + } + v = rv.Interface() var bb []byte if (code.Flags & MarshalerContextFlags) != 0 { diff --git a/vendor/github.com/goccy/go-json/internal/runtime/type.go b/vendor/github.com/goccy/go-json/internal/runtime/type.go index 0167cd2c018..4b693cb0bbe 100644 --- a/vendor/github.com/goccy/go-json/internal/runtime/type.go +++ b/vendor/github.com/goccy/go-json/internal/runtime/type.go @@ -2,6 +2,7 @@ package runtime import ( "reflect" + "sync" "unsafe" ) @@ -23,8 +24,8 @@ type TypeAddr struct { } var ( - typeAddr *TypeAddr - alreadyAnalyzed bool + typeAddr *TypeAddr + once sync.Once ) //go:linkname typelinks reflect.typelinks @@ -34,67 +35,64 @@ func typelinks() ([]unsafe.Pointer, [][]int32) func rtypeOff(unsafe.Pointer, int32) unsafe.Pointer func AnalyzeTypeAddr() *TypeAddr { - defer func() { - alreadyAnalyzed = true - }() - if alreadyAnalyzed { - return typeAddr - } - sections, offsets := typelinks() - if len(sections) != 1 { - return nil - } - if len(offsets) != 1 { - return nil - } - section := sections[0] - offset := offsets[0] - var ( - min uintptr = uintptr(^uint(0)) - max uintptr = 0 - isAligned64 = true - isAligned32 = true - ) - for i := 0; i < len(offset); i++ { - typ := (*Type)(rtypeOff(section, offset[i])) - addr := uintptr(unsafe.Pointer(typ)) - if min > addr { - min = addr + once.Do(func() { + sections, offsets := typelinks() + if len(sections) != 1 { + return } - if max < addr { - max = addr + if len(offsets) != 1 { + return } - if typ.Kind() == reflect.Ptr { - addr = uintptr(unsafe.Pointer(typ.Elem())) + section := sections[0] + offset := offsets[0] + var ( + min uintptr = uintptr(^uint(0)) + max uintptr = 0 + isAligned64 = true + isAligned32 = true + ) + for i := 0; i < len(offset); i++ { + typ := (*Type)(rtypeOff(section, offset[i])) + addr := uintptr(unsafe.Pointer(typ)) if min > addr { min = addr } if max < addr { max = addr } + if typ.Kind() == reflect.Ptr { + addr = uintptr(unsafe.Pointer(typ.Elem())) + if min > addr { + min = addr + } + if max < addr { + max = addr + } + } + isAligned64 = isAligned64 && (addr-min)&63 == 0 + isAligned32 = isAligned32 && (addr-min)&31 == 0 + } + addrRange := max - min + if addrRange == 0 { + return + } + var addrShift uintptr + if isAligned64 { + addrShift = 6 + } else if isAligned32 { + addrShift = 5 } - isAligned64 = isAligned64 && (addr-min)&63 == 0 - isAligned32 = isAligned32 && (addr-min)&31 == 0 - } - addrRange := max - min - if addrRange == 0 { - return nil - } - var addrShift uintptr - if isAligned64 { - addrShift = 6 - } else if isAligned32 { - addrShift = 5 - } - cacheSize := addrRange >> addrShift - if cacheSize > maxAcceptableTypeAddrRange { - return nil - } - typeAddr = &TypeAddr{ - BaseTypeAddr: min, - MaxTypeAddr: max, - AddrRange: addrRange, - AddrShift: addrShift, - } + cacheSize := addrRange >> addrShift + if cacheSize > maxAcceptableTypeAddrRange { + return + } + typeAddr = &TypeAddr{ + BaseTypeAddr: min, + MaxTypeAddr: max, + AddrRange: addrRange, + AddrShift: addrShift, + } + }) + return typeAddr } diff --git a/vendor/github.com/golang-migrate/migrate/v4/migrate.go b/vendor/github.com/golang-migrate/migrate/v4/migrate.go index 7763782a0cb..44efe14e30f 100644 --- a/vendor/github.com/golang-migrate/migrate/v4/migrate.go +++ b/vendor/github.com/golang-migrate/migrate/v4/migrate.go @@ -107,7 +107,7 @@ func New(sourceURL, databaseURL string) (*Migrate, error) { databaseDrv, err := database.Open(databaseURL) if err != nil { - return nil, fmt.Errorf("failed to open database, %q: %w", databaseURL, err) + return nil, fmt.Errorf("failed to open database: %w", err) } m.databaseDrv = databaseDrv @@ -157,7 +157,7 @@ func NewWithSourceInstance(sourceName string, sourceInstance source.Driver, data databaseDrv, err := database.Open(databaseURL) if err != nil { - return nil, fmt.Errorf("failed to open database, %q: %w", databaseURL, err) + return nil, fmt.Errorf("failed to open database: %w", err) } m.databaseDrv = databaseDrv diff --git a/vendor/github.com/golang/snappy/README b/vendor/github.com/golang/snappy/README index cea12879a0e..fd191f78c7f 100644 --- a/vendor/github.com/golang/snappy/README +++ b/vendor/github.com/golang/snappy/README @@ -1,8 +1,13 @@ The Snappy compression format in the Go programming language. -To download and install from source: +To use as a library: $ go get github.com/golang/snappy +To use as a binary: +$ go install github.com/golang/snappy/cmd/snappytool@latest +$ cat decoded | ~/go/bin/snappytool -e > encoded +$ cat encoded | ~/go/bin/snappytool -d > decoded + Unless otherwise noted, the Snappy-Go source files are distributed under the BSD-style license found in the LICENSE file. diff --git a/vendor/github.com/golang/snappy/encode_arm64.s b/vendor/github.com/golang/snappy/encode_arm64.s index f8d54adfc5c..f0c876a2484 100644 --- a/vendor/github.com/golang/snappy/encode_arm64.s +++ b/vendor/github.com/golang/snappy/encode_arm64.s @@ -27,7 +27,7 @@ // The unusual register allocation of local variables, such as R10 for the // source pointer, matches the allocation used at the call site in encodeBlock, // which makes it easier to manually inline this function. -TEXT ·emitLiteral(SB), NOSPLIT, $32-56 +TEXT ·emitLiteral(SB), NOSPLIT, $40-56 MOVD dst_base+0(FP), R8 MOVD lit_base+24(FP), R10 MOVD lit_len+32(FP), R3 @@ -261,7 +261,7 @@ extendMatchEnd: // "var table [maxTableSize]uint16" takes up 32768 bytes of stack space. An // extra 64 bytes, to call other functions, and an extra 64 bytes, to spill // local variables (registers) during calls gives 32768 + 64 + 64 = 32896. -TEXT ·encodeBlock(SB), 0, $32896-56 +TEXT ·encodeBlock(SB), 0, $32904-56 MOVD dst_base+0(FP), R8 MOVD src_base+24(FP), R7 MOVD src_len+32(FP), R14 diff --git a/vendor/github.com/grpc-ecosystem/grpc-gateway/v2/runtime/handler.go b/vendor/github.com/grpc-ecosystem/grpc-gateway/v2/runtime/handler.go index 0fa90765661..f0727cf7c06 100644 --- a/vendor/github.com/grpc-ecosystem/grpc-gateway/v2/runtime/handler.go +++ b/vendor/github.com/grpc-ecosystem/grpc-gateway/v2/runtime/handler.go @@ -196,7 +196,7 @@ func ForwardResponseMessage(ctx context.Context, mux *ServeMux, marshaler Marsha return } - if !doForwardTrailers { + if !doForwardTrailers && mux.writeContentLength { w.Header().Set("Content-Length", strconv.Itoa(len(buf))) } diff --git a/vendor/github.com/grpc-ecosystem/grpc-gateway/v2/runtime/mux.go b/vendor/github.com/grpc-ecosystem/grpc-gateway/v2/runtime/mux.go index 60c2065ddcb..19255ec441e 100644 --- a/vendor/github.com/grpc-ecosystem/grpc-gateway/v2/runtime/mux.go +++ b/vendor/github.com/grpc-ecosystem/grpc-gateway/v2/runtime/mux.go @@ -71,6 +71,7 @@ type ServeMux struct { routingErrorHandler RoutingErrorHandlerFunc disablePathLengthFallback bool unescapingMode UnescapingMode + writeContentLength bool } // ServeMuxOption is an option that can be given to a ServeMux on construction. @@ -258,6 +259,13 @@ func WithDisablePathLengthFallback() ServeMuxOption { } } +// WithWriteContentLength returns a ServeMuxOption to enable writing content length on non-streaming responses +func WithWriteContentLength() ServeMuxOption { + return func(serveMux *ServeMux) { + serveMux.writeContentLength = true + } +} + // WithHealthEndpointAt returns a ServeMuxOption that will add an endpoint to the created ServeMux at the path specified by endpointPath. // When called the handler will forward the request to the upstream grpc service health check (defined in the // gRPC Health Checking Protocol). diff --git a/vendor/github.com/grpc-ecosystem/grpc-gateway/v2/runtime/query.go b/vendor/github.com/grpc-ecosystem/grpc-gateway/v2/runtime/query.go index 0a1ca7e06fe..8549dfb97af 100644 --- a/vendor/github.com/grpc-ecosystem/grpc-gateway/v2/runtime/query.go +++ b/vendor/github.com/grpc-ecosystem/grpc-gateway/v2/runtime/query.go @@ -126,6 +126,15 @@ func populateFieldValueFromPath(msgValue protoreflect.Message, fieldPath []strin } } + // Check if oneof already set + if of := fieldDescriptor.ContainingOneof(); of != nil && !of.IsSynthetic() { + if f := msgValue.WhichOneof(of); f != nil { + if fieldDescriptor.Message() == nil || fieldDescriptor.FullName() != f.FullName() { + return fmt.Errorf("field already set for oneof %q", of.FullName().Name()) + } + } + } + // If this is the last element, we're done if i == len(fieldPath)-1 { break @@ -140,13 +149,6 @@ func populateFieldValueFromPath(msgValue protoreflect.Message, fieldPath []strin msgValue = msgValue.Mutable(fieldDescriptor).Message() } - // Check if oneof already set - if of := fieldDescriptor.ContainingOneof(); of != nil && !of.IsSynthetic() { - if f := msgValue.WhichOneof(of); f != nil { - return fmt.Errorf("field already set for oneof %q", of.FullName().Name()) - } - } - switch { case fieldDescriptor.IsList(): return populateRepeatedField(fieldDescriptor, msgValue.Mutable(fieldDescriptor).List(), values) diff --git a/vendor/github.com/hashicorp/consul/api/config_entry_jwt_provider.go b/vendor/github.com/hashicorp/consul/api/config_entry_jwt_provider.go index 270f0d56415..80b677b58a5 100644 --- a/vendor/github.com/hashicorp/consul/api/config_entry_jwt_provider.go +++ b/vendor/github.com/hashicorp/consul/api/config_entry_jwt_provider.go @@ -192,6 +192,12 @@ type RemoteJWKS struct { // Default value is false. FetchAsynchronously bool `json:",omitempty" alias:"fetch_asynchronously"` + // UseSNI determines whether the hostname should be set in SNI + // header for TLS connection. + // + // Default value is false. + UseSNI bool `json:",omitempty" alias:"use_sni"` + // RetryPolicy defines a retry policy for fetching JWKS. // // There is no retry by default. diff --git a/vendor/github.com/hashicorp/consul/api/health.go b/vendor/github.com/hashicorp/consul/api/health.go index a0230020460..60a5b3dee8a 100644 --- a/vendor/github.com/hashicorp/consul/api/health.go +++ b/vendor/github.com/hashicorp/consul/api/health.go @@ -75,6 +75,8 @@ type HealthCheckDefinition struct { IntervalDuration time.Duration `json:"-"` TimeoutDuration time.Duration `json:"-"` DeregisterCriticalServiceAfterDuration time.Duration `json:"-"` + // when parent Type is `session`, and if this session is destroyed, the check will be marked as critical + SessionName string `json:",omitempty"` // DEPRECATED in Consul 1.4.1. Use the above time.Duration fields instead. Interval ReadableDuration diff --git a/vendor/github.com/klauspost/compress/README.md b/vendor/github.com/klauspost/compress/README.md index de264c85a5a..244ee19c4bf 100644 --- a/vendor/github.com/klauspost/compress/README.md +++ b/vendor/github.com/klauspost/compress/README.md @@ -14,8 +14,34 @@ This package provides various compression algorithms. [![Go](https://github.com/klauspost/compress/actions/workflows/go.yml/badge.svg)](https://github.com/klauspost/compress/actions/workflows/go.yml) [![Sourcegraph Badge](https://sourcegraph.com/github.com/klauspost/compress/-/badge.svg)](https://sourcegraph.com/github.com/klauspost/compress?badge) +# package usage + +Use `go get github.com/klauspost/compress@latest` to add it to your project. + +This package will support the current Go version and 2 versions back. + +* Use the `nounsafe` tag to disable all use of the "unsafe" package. +* Use the `noasm` tag to disable all assembly across packages. + +Use the links above for more information on each. + # changelog +* Feb 19th, 2025 - [1.18.0](https://github.com/klauspost/compress/releases/tag/v1.18.0) + * Add unsafe little endian loaders https://github.com/klauspost/compress/pull/1036 + * fix: check `r.err != nil` but return a nil value error `err` by @alingse in https://github.com/klauspost/compress/pull/1028 + * flate: Simplify L4-6 loading https://github.com/klauspost/compress/pull/1043 + * flate: Simplify matchlen (remove asm) https://github.com/klauspost/compress/pull/1045 + * s2: Improve small block compression speed w/o asm https://github.com/klauspost/compress/pull/1048 + * flate: Fix matchlen L5+L6 https://github.com/klauspost/compress/pull/1049 + * flate: Cleanup & reduce casts https://github.com/klauspost/compress/pull/1050 + +* Oct 11th, 2024 - [1.17.11](https://github.com/klauspost/compress/releases/tag/v1.17.11) + * zstd: Fix extra CRC written with multiple Close calls https://github.com/klauspost/compress/pull/1017 + * s2: Don't use stack for index tables https://github.com/klauspost/compress/pull/1014 + * gzhttp: No content-type on no body response code by @juliens in https://github.com/klauspost/compress/pull/1011 + * gzhttp: Do not set the content-type when response has no body by @kevinpollet in https://github.com/klauspost/compress/pull/1013 + * Sep 23rd, 2024 - [1.17.10](https://github.com/klauspost/compress/releases/tag/v1.17.10) * gzhttp: Add TransportAlwaysDecompress option. https://github.com/klauspost/compress/pull/978 * gzhttp: Add supported decompress request body by @mirecl in https://github.com/klauspost/compress/pull/1002 @@ -65,9 +91,9 @@ https://github.com/klauspost/compress/pull/919 https://github.com/klauspost/comp * zstd: Fix rare *CORRUPTION* output in "best" mode. See https://github.com/klauspost/compress/pull/876 * Oct 14th, 2023 - [v1.17.1](https://github.com/klauspost/compress/releases/tag/v1.17.1) - * s2: Fix S2 "best" dictionary wrong encoding by @klauspost in https://github.com/klauspost/compress/pull/871 + * s2: Fix S2 "best" dictionary wrong encoding https://github.com/klauspost/compress/pull/871 * flate: Reduce allocations in decompressor and minor code improvements by @fakefloordiv in https://github.com/klauspost/compress/pull/869 - * s2: Fix EstimateBlockSize on 6&7 length input by @klauspost in https://github.com/klauspost/compress/pull/867 + * s2: Fix EstimateBlockSize on 6&7 length input https://github.com/klauspost/compress/pull/867 * Sept 19th, 2023 - [v1.17.0](https://github.com/klauspost/compress/releases/tag/v1.17.0) * Add experimental dictionary builder https://github.com/klauspost/compress/pull/853 @@ -124,7 +150,7 @@ https://github.com/klauspost/compress/pull/919 https://github.com/klauspost/comp See changes to v1.15.x * Jan 21st, 2023 (v1.15.15) - * deflate: Improve level 7-9 by @klauspost in https://github.com/klauspost/compress/pull/739 + * deflate: Improve level 7-9 https://github.com/klauspost/compress/pull/739 * zstd: Add delta encoding support by @greatroar in https://github.com/klauspost/compress/pull/728 * zstd: Various speed improvements by @greatroar https://github.com/klauspost/compress/pull/741 https://github.com/klauspost/compress/pull/734 https://github.com/klauspost/compress/pull/736 https://github.com/klauspost/compress/pull/744 https://github.com/klauspost/compress/pull/743 https://github.com/klauspost/compress/pull/745 * gzhttp: Add SuffixETag() and DropETag() options to prevent ETag collisions on compressed responses by @willbicks in https://github.com/klauspost/compress/pull/740 @@ -167,7 +193,7 @@ https://github.com/klauspost/compress/pull/919 https://github.com/klauspost/comp * zstd: Fix decoder crash on amd64 (no BMI) on invalid input https://github.com/klauspost/compress/pull/645 * zstd: Disable decoder extended memory copies (amd64) due to possible crashes https://github.com/klauspost/compress/pull/644 - * zstd: Allow single segments up to "max decoded size" by @klauspost in https://github.com/klauspost/compress/pull/643 + * zstd: Allow single segments up to "max decoded size" https://github.com/klauspost/compress/pull/643 * July 13, 2022 (v1.15.8) @@ -209,7 +235,7 @@ https://github.com/klauspost/compress/pull/919 https://github.com/klauspost/comp * zstd: Speed up when WithDecoderLowmem(false) https://github.com/klauspost/compress/pull/599 * zstd: faster next state update in BMI2 version of decode by @WojciechMula in https://github.com/klauspost/compress/pull/593 * huff0: Do not check max size when reading table. https://github.com/klauspost/compress/pull/586 - * flate: Inplace hashing for level 7-9 by @klauspost in https://github.com/klauspost/compress/pull/590 + * flate: Inplace hashing for level 7-9 https://github.com/klauspost/compress/pull/590 * May 11, 2022 (v1.15.4) @@ -236,12 +262,12 @@ https://github.com/klauspost/compress/pull/919 https://github.com/klauspost/comp * zstd: Add stricter block size checks in [#523](https://github.com/klauspost/compress/pull/523) * Mar 3, 2022 (v1.15.0) - * zstd: Refactor decoder by @klauspost in [#498](https://github.com/klauspost/compress/pull/498) - * zstd: Add stream encoding without goroutines by @klauspost in [#505](https://github.com/klauspost/compress/pull/505) + * zstd: Refactor decoder [#498](https://github.com/klauspost/compress/pull/498) + * zstd: Add stream encoding without goroutines [#505](https://github.com/klauspost/compress/pull/505) * huff0: Prevent single blocks exceeding 16 bits by @klauspost in[#507](https://github.com/klauspost/compress/pull/507) - * flate: Inline literal emission by @klauspost in [#509](https://github.com/klauspost/compress/pull/509) - * gzhttp: Add zstd to transport by @klauspost in [#400](https://github.com/klauspost/compress/pull/400) - * gzhttp: Make content-type optional by @klauspost in [#510](https://github.com/klauspost/compress/pull/510) + * flate: Inline literal emission [#509](https://github.com/klauspost/compress/pull/509) + * gzhttp: Add zstd to transport [#400](https://github.com/klauspost/compress/pull/400) + * gzhttp: Make content-type optional [#510](https://github.com/klauspost/compress/pull/510) Both compression and decompression now supports "synchronous" stream operations. This means that whenever "concurrency" is set to 1, they will operate without spawning goroutines. @@ -258,7 +284,7 @@ While the release has been extensively tested, it is recommended to testing when * flate: Fix rare huffman only (-2) corruption. [#503](https://github.com/klauspost/compress/pull/503) * zip: Update deprecated CreateHeaderRaw to correctly call CreateRaw by @saracen in [#502](https://github.com/klauspost/compress/pull/502) * zip: don't read data descriptor early by @saracen in [#501](https://github.com/klauspost/compress/pull/501) #501 - * huff0: Use static decompression buffer up to 30% faster by @klauspost in [#499](https://github.com/klauspost/compress/pull/499) [#500](https://github.com/klauspost/compress/pull/500) + * huff0: Use static decompression buffer up to 30% faster [#499](https://github.com/klauspost/compress/pull/499) [#500](https://github.com/klauspost/compress/pull/500) * Feb 17, 2022 (v1.14.3) * flate: Improve fastest levels compression speed ~10% more throughput. [#482](https://github.com/klauspost/compress/pull/482) [#489](https://github.com/klauspost/compress/pull/489) [#490](https://github.com/klauspost/compress/pull/490) [#491](https://github.com/klauspost/compress/pull/491) [#494](https://github.com/klauspost/compress/pull/494) [#478](https://github.com/klauspost/compress/pull/478) @@ -565,12 +591,14 @@ While the release has been extensively tested, it is recommended to testing when The packages are drop-in replacements for standard libraries. Simply replace the import path to use them: -| old import | new import | Documentation -|--------------------|-----------------------------------------|--------------------| -| `compress/gzip` | `github.com/klauspost/compress/gzip` | [gzip](https://pkg.go.dev/github.com/klauspost/compress/gzip?tab=doc) -| `compress/zlib` | `github.com/klauspost/compress/zlib` | [zlib](https://pkg.go.dev/github.com/klauspost/compress/zlib?tab=doc) -| `archive/zip` | `github.com/klauspost/compress/zip` | [zip](https://pkg.go.dev/github.com/klauspost/compress/zip?tab=doc) -| `compress/flate` | `github.com/klauspost/compress/flate` | [flate](https://pkg.go.dev/github.com/klauspost/compress/flate?tab=doc) +Typical speed is about 2x of the standard library packages. + +| old import | new import | Documentation | +|------------------|---------------------------------------|-------------------------------------------------------------------------| +| `compress/gzip` | `github.com/klauspost/compress/gzip` | [gzip](https://pkg.go.dev/github.com/klauspost/compress/gzip?tab=doc) | +| `compress/zlib` | `github.com/klauspost/compress/zlib` | [zlib](https://pkg.go.dev/github.com/klauspost/compress/zlib?tab=doc) | +| `archive/zip` | `github.com/klauspost/compress/zip` | [zip](https://pkg.go.dev/github.com/klauspost/compress/zip?tab=doc) | +| `compress/flate` | `github.com/klauspost/compress/flate` | [flate](https://pkg.go.dev/github.com/klauspost/compress/flate?tab=doc) | * Optimized [deflate](https://godoc.org/github.com/klauspost/compress/flate) packages which can be used as a dropin replacement for [gzip](https://godoc.org/github.com/klauspost/compress/gzip), [zip](https://godoc.org/github.com/klauspost/compress/zip) and [zlib](https://godoc.org/github.com/klauspost/compress/zlib). @@ -625,84 +653,6 @@ This will only use up to 4KB in memory when the writer is idle. Compression is almost always worse than the fastest compression level and each write will allocate (a little) memory. -# Performance Update 2018 - -It has been a while since we have been looking at the speed of this package compared to the standard library, so I thought I would re-do my tests and give some overall recommendations based on the current state. All benchmarks have been performed with Go 1.10 on my Desktop Intel(R) Core(TM) i7-2600 CPU @3.40GHz. Since I last ran the tests, I have gotten more RAM, which means tests with big files are no longer limited by my SSD. - -The raw results are in my [updated spreadsheet](https://docs.google.com/spreadsheets/d/1nuNE2nPfuINCZJRMt6wFWhKpToF95I47XjSsc-1rbPQ/edit?usp=sharing). Due to cgo changes and upstream updates i could not get the cgo version of gzip to compile. Instead I included the [zstd](https://github.com/datadog/zstd) cgo implementation. If I get cgo gzip to work again, I might replace the results in the sheet. - -The columns to take note of are: *MB/s* - the throughput. *Reduction* - the data size reduction in percent of the original. *Rel Speed* relative speed compared to the standard library at the same level. *Smaller* - how many percent smaller is the compressed output compared to stdlib. Negative means the output was bigger. *Loss* means the loss (or gain) in compression as a percentage difference of the input. - -The `gzstd` (standard library gzip) and `gzkp` (this package gzip) only uses one CPU core. [`pgzip`](https://github.com/klauspost/pgzip), [`bgzf`](https://github.com/biogo/hts/tree/master/bgzf) uses all 4 cores. [`zstd`](https://github.com/DataDog/zstd) uses one core, and is a beast (but not Go, yet). - - -## Overall differences. - -There appears to be a roughly 5-10% speed advantage over the standard library when comparing at similar compression levels. - -The biggest difference you will see is the result of [re-balancing](https://blog.klauspost.com/rebalancing-deflate-compression-levels/) the compression levels. I wanted by library to give a smoother transition between the compression levels than the standard library. - -This package attempts to provide a more smooth transition, where "1" is taking a lot of shortcuts, "5" is the reasonable trade-off and "9" is the "give me the best compression", and the values in between gives something reasonable in between. The standard library has big differences in levels 1-4, but levels 5-9 having no significant gains - often spending a lot more time than can be justified by the achieved compression. - -There are links to all the test data in the [spreadsheet](https://docs.google.com/spreadsheets/d/1nuNE2nPfuINCZJRMt6wFWhKpToF95I47XjSsc-1rbPQ/edit?usp=sharing) in the top left field on each tab. - -## Web Content - -This test set aims to emulate typical use in a web server. The test-set is 4GB data in 53k files, and is a mixture of (mostly) HTML, JS, CSS. - -Since level 1 and 9 are close to being the same code, they are quite close. But looking at the levels in-between the differences are quite big. - -Looking at level 6, this package is 88% faster, but will output about 6% more data. For a web server, this means you can serve 88% more data, but have to pay for 6% more bandwidth. You can draw your own conclusions on what would be the most expensive for your case. - -## Object files - -This test is for typical data files stored on a server. In this case it is a collection of Go precompiled objects. They are very compressible. - -The picture is similar to the web content, but with small differences since this is very compressible. Levels 2-3 offer good speed, but is sacrificing quite a bit of compression. - -The standard library seems suboptimal on level 3 and 4 - offering both worse compression and speed than level 6 & 7 of this package respectively. - -## Highly Compressible File - -This is a JSON file with very high redundancy. The reduction starts at 95% on level 1, so in real life terms we are dealing with something like a highly redundant stream of data, etc. - -It is definitely visible that we are dealing with specialized content here, so the results are very scattered. This package does not do very well at levels 1-4, but picks up significantly at level 5 and levels 7 and 8 offering great speed for the achieved compression. - -So if you know you content is extremely compressible you might want to go slightly higher than the defaults. The standard library has a huge gap between levels 3 and 4 in terms of speed (2.75x slowdown), so it offers little "middle ground". - -## Medium-High Compressible - -This is a pretty common test corpus: [enwik9](http://mattmahoney.net/dc/textdata.html). It contains the first 10^9 bytes of the English Wikipedia dump on Mar. 3, 2006. This is a very good test of typical text based compression and more data heavy streams. - -We see a similar picture here as in "Web Content". On equal levels some compression is sacrificed for more speed. Level 5 seems to be the best trade-off between speed and size, beating stdlib level 3 in both. - -## Medium Compressible - -I will combine two test sets, one [10GB file set](http://mattmahoney.net/dc/10gb.html) and a VM disk image (~8GB). Both contain different data types and represent a typical backup scenario. - -The most notable thing is how quickly the standard library drops to very low compression speeds around level 5-6 without any big gains in compression. Since this type of data is fairly common, this does not seem like good behavior. - - -## Un-compressible Content - -This is mainly a test of how good the algorithms are at detecting un-compressible input. The standard library only offers this feature with very conservative settings at level 1. Obviously there is no reason for the algorithms to try to compress input that cannot be compressed. The only downside is that it might skip some compressible data on false detections. - - -## Huffman only compression - -This compression library adds a special compression level, named `HuffmanOnly`, which allows near linear time compression. This is done by completely disabling matching of previous data, and only reduce the number of bits to represent each character. - -This means that often used characters, like 'e' and ' ' (space) in text use the fewest bits to represent, and rare characters like '¤' takes more bits to represent. For more information see [wikipedia](https://en.wikipedia.org/wiki/Huffman_coding) or this nice [video](https://youtu.be/ZdooBTdW5bM). - -Since this type of compression has much less variance, the compression speed is mostly unaffected by the input data, and is usually more than *180MB/s* for a single core. - -The downside is that the compression ratio is usually considerably worse than even the fastest conventional compression. The compression ratio can never be better than 8:1 (12.5%). - -The linear time compression can be used as a "better than nothing" mode, where you cannot risk the encoder to slow down on some content. For comparison, the size of the "Twain" text is *233460 bytes* (+29% vs. level 1) and encode speed is 144MB/s (4.5x level 1). So in this case you trade a 30% size increase for a 4 times speedup. - -For more information see my blog post on [Fast Linear Time Compression](http://blog.klauspost.com/constant-time-gzipzip-compression/). - -This is implemented on Go 1.7 as "Huffman Only" mode, though not exposed for gzip. # Other packages diff --git a/vendor/github.com/klauspost/compress/flate/fast_encoder.go b/vendor/github.com/klauspost/compress/flate/fast_encoder.go index c8124b5c49a..0e8b1630c04 100644 --- a/vendor/github.com/klauspost/compress/flate/fast_encoder.go +++ b/vendor/github.com/klauspost/compress/flate/fast_encoder.go @@ -6,8 +6,10 @@ package flate import ( - "encoding/binary" "fmt" + "math/bits" + + "github.com/klauspost/compress/internal/le" ) type fastEnc interface { @@ -58,11 +60,11 @@ const ( ) func load3232(b []byte, i int32) uint32 { - return binary.LittleEndian.Uint32(b[i:]) + return le.Load32(b, i) } func load6432(b []byte, i int32) uint64 { - return binary.LittleEndian.Uint64(b[i:]) + return le.Load64(b, i) } type tableEntry struct { @@ -134,8 +136,8 @@ func hashLen(u uint64, length, mls uint8) uint32 { // matchlen will return the match length between offsets and t in src. // The maximum length returned is maxMatchLength - 4. // It is assumed that s > t, that t >=0 and s < len(src). -func (e *fastGen) matchlen(s, t int32, src []byte) int32 { - if debugDecode { +func (e *fastGen) matchlen(s, t int, src []byte) int32 { + if debugDeflate { if t >= s { panic(fmt.Sprint("t >=s:", t, s)) } @@ -149,18 +151,34 @@ func (e *fastGen) matchlen(s, t int32, src []byte) int32 { panic(fmt.Sprint(s, "-", t, "(", s-t, ") > maxMatchLength (", maxMatchOffset, ")")) } } - s1 := int(s) + maxMatchLength - 4 - if s1 > len(src) { - s1 = len(src) + s1 := min(s+maxMatchLength-4, len(src)) + left := s1 - s + n := int32(0) + for left >= 8 { + diff := le.Load64(src, s) ^ le.Load64(src, t) + if diff != 0 { + return n + int32(bits.TrailingZeros64(diff)>>3) + } + s += 8 + t += 8 + n += 8 + left -= 8 } - // Extend the match to be as long as possible. - return int32(matchLen(src[s:s1], src[t:])) + a := src[s:s1] + b := src[t:] + for i := range a { + if a[i] != b[i] { + break + } + n++ + } + return n } // matchlenLong will return the match length between offsets and t in src. // It is assumed that s > t, that t >=0 and s < len(src). -func (e *fastGen) matchlenLong(s, t int32, src []byte) int32 { +func (e *fastGen) matchlenLong(s, t int, src []byte) int32 { if debugDeflate { if t >= s { panic(fmt.Sprint("t >=s:", t, s)) @@ -176,7 +194,28 @@ func (e *fastGen) matchlenLong(s, t int32, src []byte) int32 { } } // Extend the match to be as long as possible. - return int32(matchLen(src[s:], src[t:])) + left := len(src) - s + n := int32(0) + for left >= 8 { + diff := le.Load64(src, s) ^ le.Load64(src, t) + if diff != 0 { + return n + int32(bits.TrailingZeros64(diff)>>3) + } + s += 8 + t += 8 + n += 8 + left -= 8 + } + + a := src[s:] + b := src[t:] + for i := range a { + if a[i] != b[i] { + break + } + n++ + } + return n } // Reset the encoding table. diff --git a/vendor/github.com/klauspost/compress/flate/huffman_bit_writer.go b/vendor/github.com/klauspost/compress/flate/huffman_bit_writer.go index f70594c34eb..afdc8c053a0 100644 --- a/vendor/github.com/klauspost/compress/flate/huffman_bit_writer.go +++ b/vendor/github.com/klauspost/compress/flate/huffman_bit_writer.go @@ -5,10 +5,11 @@ package flate import ( - "encoding/binary" "fmt" "io" "math" + + "github.com/klauspost/compress/internal/le" ) const ( @@ -438,7 +439,7 @@ func (w *huffmanBitWriter) writeOutBits() { n := w.nbytes // We over-write, but faster... - binary.LittleEndian.PutUint64(w.bytes[n:], bits) + le.Store64(w.bytes[n:], bits) n += 6 if n >= bufferFlushSize { @@ -854,7 +855,7 @@ func (w *huffmanBitWriter) writeTokens(tokens []token, leCodes, oeCodes []hcode) bits |= c.code64() << (nbits & 63) nbits += c.len() if nbits >= 48 { - binary.LittleEndian.PutUint64(w.bytes[nbytes:], bits) + le.Store64(w.bytes[nbytes:], bits) //*(*uint64)(unsafe.Pointer(&w.bytes[nbytes])) = bits bits >>= 48 nbits -= 48 @@ -882,7 +883,7 @@ func (w *huffmanBitWriter) writeTokens(tokens []token, leCodes, oeCodes []hcode) bits |= c.code64() << (nbits & 63) nbits += c.len() if nbits >= 48 { - binary.LittleEndian.PutUint64(w.bytes[nbytes:], bits) + le.Store64(w.bytes[nbytes:], bits) //*(*uint64)(unsafe.Pointer(&w.bytes[nbytes])) = bits bits >>= 48 nbits -= 48 @@ -905,7 +906,7 @@ func (w *huffmanBitWriter) writeTokens(tokens []token, leCodes, oeCodes []hcode) bits |= uint64(extraLength) << (nbits & 63) nbits += extraLengthBits if nbits >= 48 { - binary.LittleEndian.PutUint64(w.bytes[nbytes:], bits) + le.Store64(w.bytes[nbytes:], bits) //*(*uint64)(unsafe.Pointer(&w.bytes[nbytes])) = bits bits >>= 48 nbits -= 48 @@ -931,7 +932,7 @@ func (w *huffmanBitWriter) writeTokens(tokens []token, leCodes, oeCodes []hcode) bits |= c.code64() << (nbits & 63) nbits += c.len() if nbits >= 48 { - binary.LittleEndian.PutUint64(w.bytes[nbytes:], bits) + le.Store64(w.bytes[nbytes:], bits) //*(*uint64)(unsafe.Pointer(&w.bytes[nbytes])) = bits bits >>= 48 nbits -= 48 @@ -953,7 +954,7 @@ func (w *huffmanBitWriter) writeTokens(tokens []token, leCodes, oeCodes []hcode) bits |= uint64((offset-(offsetComb>>8))&matchOffsetOnlyMask) << (nbits & 63) nbits += uint8(offsetComb) if nbits >= 48 { - binary.LittleEndian.PutUint64(w.bytes[nbytes:], bits) + le.Store64(w.bytes[nbytes:], bits) //*(*uint64)(unsafe.Pointer(&w.bytes[nbytes])) = bits bits >>= 48 nbits -= 48 @@ -1107,7 +1108,7 @@ func (w *huffmanBitWriter) writeBlockHuff(eof bool, input []byte, sync bool) { // We must have at least 48 bits free. if nbits >= 8 { n := nbits >> 3 - binary.LittleEndian.PutUint64(w.bytes[nbytes:], bits) + le.Store64(w.bytes[nbytes:], bits) bits >>= (n * 8) & 63 nbits -= n * 8 nbytes += n @@ -1136,7 +1137,7 @@ func (w *huffmanBitWriter) writeBlockHuff(eof bool, input []byte, sync bool) { // Remaining... for _, t := range input { if nbits >= 48 { - binary.LittleEndian.PutUint64(w.bytes[nbytes:], bits) + le.Store64(w.bytes[nbytes:], bits) //*(*uint64)(unsafe.Pointer(&w.bytes[nbytes])) = bits bits >>= 48 nbits -= 48 diff --git a/vendor/github.com/klauspost/compress/flate/level1.go b/vendor/github.com/klauspost/compress/flate/level1.go index 703b9a89aa3..c3581a3420e 100644 --- a/vendor/github.com/klauspost/compress/flate/level1.go +++ b/vendor/github.com/klauspost/compress/flate/level1.go @@ -1,9 +1,9 @@ package flate import ( - "encoding/binary" "fmt" - "math/bits" + + "github.com/klauspost/compress/internal/le" ) // fastGen maintains the table for matches, @@ -77,6 +77,7 @@ func (e *fastEncL1) Encode(dst *tokens, src []byte) { nextS := s var candidate tableEntry + var t int32 for { nextHash := hashLen(cv, tableBits, hashBytes) candidate = e.table[nextHash] @@ -88,9 +89,8 @@ func (e *fastEncL1) Encode(dst *tokens, src []byte) { now := load6432(src, nextS) e.table[nextHash] = tableEntry{offset: s + e.cur} nextHash = hashLen(now, tableBits, hashBytes) - - offset := s - (candidate.offset - e.cur) - if offset < maxMatchOffset && uint32(cv) == load3232(src, candidate.offset-e.cur) { + t = candidate.offset - e.cur + if s-t < maxMatchOffset && uint32(cv) == load3232(src, t) { e.table[nextHash] = tableEntry{offset: nextS + e.cur} break } @@ -103,8 +103,8 @@ func (e *fastEncL1) Encode(dst *tokens, src []byte) { now >>= 8 e.table[nextHash] = tableEntry{offset: s + e.cur} - offset = s - (candidate.offset - e.cur) - if offset < maxMatchOffset && uint32(cv) == load3232(src, candidate.offset-e.cur) { + t = candidate.offset - e.cur + if s-t < maxMatchOffset && uint32(cv) == load3232(src, t) { e.table[nextHash] = tableEntry{offset: nextS + e.cur} break } @@ -120,36 +120,10 @@ func (e *fastEncL1) Encode(dst *tokens, src []byte) { // literal bytes prior to s. // Extend the 4-byte match as long as possible. - t := candidate.offset - e.cur - var l = int32(4) - if false { - l = e.matchlenLong(s+4, t+4, src) + 4 - } else { - // inlined: - a := src[s+4:] - b := src[t+4:] - for len(a) >= 8 { - if diff := binary.LittleEndian.Uint64(a) ^ binary.LittleEndian.Uint64(b); diff != 0 { - l += int32(bits.TrailingZeros64(diff) >> 3) - break - } - l += 8 - a = a[8:] - b = b[8:] - } - if len(a) < 8 { - b = b[:len(a)] - for i := range a { - if a[i] != b[i] { - break - } - l++ - } - } - } + l := e.matchlenLong(int(s+4), int(t+4), src) + 4 // Extend backwards - for t > 0 && s > nextEmit && src[t-1] == src[s-1] { + for t > 0 && s > nextEmit && le.Load8(src, t-1) == le.Load8(src, s-1) { s-- t-- l++ @@ -221,8 +195,8 @@ func (e *fastEncL1) Encode(dst *tokens, src []byte) { candidate = e.table[currHash] e.table[currHash] = tableEntry{offset: o + 2} - offset := s - (candidate.offset - e.cur) - if offset > maxMatchOffset || uint32(x) != load3232(src, candidate.offset-e.cur) { + t = candidate.offset - e.cur + if s-t > maxMatchOffset || uint32(x) != load3232(src, t) { cv = x >> 8 s++ break diff --git a/vendor/github.com/klauspost/compress/flate/level2.go b/vendor/github.com/klauspost/compress/flate/level2.go index 876dfbe3054..c8d047f2d93 100644 --- a/vendor/github.com/klauspost/compress/flate/level2.go +++ b/vendor/github.com/klauspost/compress/flate/level2.go @@ -126,7 +126,7 @@ func (e *fastEncL2) Encode(dst *tokens, src []byte) { // Extend the 4-byte match as long as possible. t := candidate.offset - e.cur - l := e.matchlenLong(s+4, t+4, src) + 4 + l := e.matchlenLong(int(s+4), int(t+4), src) + 4 // Extend backwards for t > 0 && s > nextEmit && src[t-1] == src[s-1] { diff --git a/vendor/github.com/klauspost/compress/flate/level3.go b/vendor/github.com/klauspost/compress/flate/level3.go index 7aa2b72a129..33f9fb1525b 100644 --- a/vendor/github.com/klauspost/compress/flate/level3.go +++ b/vendor/github.com/klauspost/compress/flate/level3.go @@ -135,7 +135,7 @@ func (e *fastEncL3) Encode(dst *tokens, src []byte) { // Extend the 4-byte match as long as possible. // t := candidate.offset - e.cur - l := e.matchlenLong(s+4, t+4, src) + 4 + l := e.matchlenLong(int(s+4), int(t+4), src) + 4 // Extend backwards for t > 0 && s > nextEmit && src[t-1] == src[s-1] { diff --git a/vendor/github.com/klauspost/compress/flate/level4.go b/vendor/github.com/klauspost/compress/flate/level4.go index 23c08b325cf..88509e1973c 100644 --- a/vendor/github.com/klauspost/compress/flate/level4.go +++ b/vendor/github.com/klauspost/compress/flate/level4.go @@ -98,19 +98,19 @@ func (e *fastEncL4) Encode(dst *tokens, src []byte) { e.bTable[nextHashL] = entry t = lCandidate.offset - e.cur - if s-t < maxMatchOffset && uint32(cv) == load3232(src, lCandidate.offset-e.cur) { + if s-t < maxMatchOffset && uint32(cv) == load3232(src, t) { // We got a long match. Use that. break } t = sCandidate.offset - e.cur - if s-t < maxMatchOffset && uint32(cv) == load3232(src, sCandidate.offset-e.cur) { + if s-t < maxMatchOffset && uint32(cv) == load3232(src, t) { // Found a 4 match... lCandidate = e.bTable[hash7(next, tableBits)] // If the next long is a candidate, check if we should use that instead... - lOff := nextS - (lCandidate.offset - e.cur) - if lOff < maxMatchOffset && load3232(src, lCandidate.offset-e.cur) == uint32(next) { + lOff := lCandidate.offset - e.cur + if nextS-lOff < maxMatchOffset && load3232(src, lOff) == uint32(next) { l1, l2 := matchLen(src[s+4:], src[t+4:]), matchLen(src[nextS+4:], src[nextS-lOff+4:]) if l2 > l1 { s = nextS @@ -127,7 +127,7 @@ func (e *fastEncL4) Encode(dst *tokens, src []byte) { // them as literal bytes. // Extend the 4-byte match as long as possible. - l := e.matchlenLong(s+4, t+4, src) + 4 + l := e.matchlenLong(int(s+4), int(t+4), src) + 4 // Extend backwards for t > 0 && s > nextEmit && src[t-1] == src[s-1] { diff --git a/vendor/github.com/klauspost/compress/flate/level5.go b/vendor/github.com/klauspost/compress/flate/level5.go index 1f61ec1829d..6e5c21502f7 100644 --- a/vendor/github.com/klauspost/compress/flate/level5.go +++ b/vendor/github.com/klauspost/compress/flate/level5.go @@ -111,16 +111,16 @@ func (e *fastEncL5) Encode(dst *tokens, src []byte) { t = lCandidate.Cur.offset - e.cur if s-t < maxMatchOffset { - if uint32(cv) == load3232(src, lCandidate.Cur.offset-e.cur) { + if uint32(cv) == load3232(src, t) { // Store the next match e.table[nextHashS] = tableEntry{offset: nextS + e.cur} eLong := &e.bTable[nextHashL] eLong.Cur, eLong.Prev = tableEntry{offset: nextS + e.cur}, eLong.Cur t2 := lCandidate.Prev.offset - e.cur - if s-t2 < maxMatchOffset && uint32(cv) == load3232(src, lCandidate.Prev.offset-e.cur) { - l = e.matchlen(s+4, t+4, src) + 4 - ml1 := e.matchlen(s+4, t2+4, src) + 4 + if s-t2 < maxMatchOffset && uint32(cv) == load3232(src, t2) { + l = e.matchlen(int(s+4), int(t+4), src) + 4 + ml1 := e.matchlen(int(s+4), int(t2+4), src) + 4 if ml1 > l { t = t2 l = ml1 @@ -130,7 +130,7 @@ func (e *fastEncL5) Encode(dst *tokens, src []byte) { break } t = lCandidate.Prev.offset - e.cur - if s-t < maxMatchOffset && uint32(cv) == load3232(src, lCandidate.Prev.offset-e.cur) { + if s-t < maxMatchOffset && uint32(cv) == load3232(src, t) { // Store the next match e.table[nextHashS] = tableEntry{offset: nextS + e.cur} eLong := &e.bTable[nextHashL] @@ -140,9 +140,9 @@ func (e *fastEncL5) Encode(dst *tokens, src []byte) { } t = sCandidate.offset - e.cur - if s-t < maxMatchOffset && uint32(cv) == load3232(src, sCandidate.offset-e.cur) { + if s-t < maxMatchOffset && uint32(cv) == load3232(src, t) { // Found a 4 match... - l = e.matchlen(s+4, t+4, src) + 4 + l = e.matchlen(int(s+4), int(t+4), src) + 4 lCandidate = e.bTable[nextHashL] // Store the next match @@ -153,8 +153,8 @@ func (e *fastEncL5) Encode(dst *tokens, src []byte) { // If the next long is a candidate, use that... t2 := lCandidate.Cur.offset - e.cur if nextS-t2 < maxMatchOffset { - if load3232(src, lCandidate.Cur.offset-e.cur) == uint32(next) { - ml := e.matchlen(nextS+4, t2+4, src) + 4 + if load3232(src, t2) == uint32(next) { + ml := e.matchlen(int(nextS+4), int(t2+4), src) + 4 if ml > l { t = t2 s = nextS @@ -164,8 +164,8 @@ func (e *fastEncL5) Encode(dst *tokens, src []byte) { } // If the previous long is a candidate, use that... t2 = lCandidate.Prev.offset - e.cur - if nextS-t2 < maxMatchOffset && load3232(src, lCandidate.Prev.offset-e.cur) == uint32(next) { - ml := e.matchlen(nextS+4, t2+4, src) + 4 + if nextS-t2 < maxMatchOffset && load3232(src, t2) == uint32(next) { + ml := e.matchlen(int(nextS+4), int(t2+4), src) + 4 if ml > l { t = t2 s = nextS @@ -185,9 +185,9 @@ func (e *fastEncL5) Encode(dst *tokens, src []byte) { if l == 0 { // Extend the 4-byte match as long as possible. - l = e.matchlenLong(s+4, t+4, src) + 4 + l = e.matchlenLong(int(s+4), int(t+4), src) + 4 } else if l == maxMatchLength { - l += e.matchlenLong(s+l, t+l, src) + l += e.matchlenLong(int(s+l), int(t+l), src) } // Try to locate a better match by checking the end of best match... @@ -203,7 +203,7 @@ func (e *fastEncL5) Encode(dst *tokens, src []byte) { s2 := s + skipBeginning off := s2 - t2 if t2 >= 0 && off < maxMatchOffset && off > 0 { - if l2 := e.matchlenLong(s2, t2, src); l2 > l { + if l2 := e.matchlenLong(int(s2), int(t2), src); l2 > l { t = t2 l = l2 s = s2 @@ -423,14 +423,14 @@ func (e *fastEncL5Window) Encode(dst *tokens, src []byte) { t = lCandidate.Cur.offset - e.cur if s-t < maxMatchOffset { - if uint32(cv) == load3232(src, lCandidate.Cur.offset-e.cur) { + if uint32(cv) == load3232(src, t) { // Store the next match e.table[nextHashS] = tableEntry{offset: nextS + e.cur} eLong := &e.bTable[nextHashL] eLong.Cur, eLong.Prev = tableEntry{offset: nextS + e.cur}, eLong.Cur t2 := lCandidate.Prev.offset - e.cur - if s-t2 < maxMatchOffset && uint32(cv) == load3232(src, lCandidate.Prev.offset-e.cur) { + if s-t2 < maxMatchOffset && uint32(cv) == load3232(src, t2) { l = e.matchlen(s+4, t+4, src) + 4 ml1 := e.matchlen(s+4, t2+4, src) + 4 if ml1 > l { @@ -442,7 +442,7 @@ func (e *fastEncL5Window) Encode(dst *tokens, src []byte) { break } t = lCandidate.Prev.offset - e.cur - if s-t < maxMatchOffset && uint32(cv) == load3232(src, lCandidate.Prev.offset-e.cur) { + if s-t < maxMatchOffset && uint32(cv) == load3232(src, t) { // Store the next match e.table[nextHashS] = tableEntry{offset: nextS + e.cur} eLong := &e.bTable[nextHashL] @@ -452,7 +452,7 @@ func (e *fastEncL5Window) Encode(dst *tokens, src []byte) { } t = sCandidate.offset - e.cur - if s-t < maxMatchOffset && uint32(cv) == load3232(src, sCandidate.offset-e.cur) { + if s-t < maxMatchOffset && uint32(cv) == load3232(src, t) { // Found a 4 match... l = e.matchlen(s+4, t+4, src) + 4 lCandidate = e.bTable[nextHashL] @@ -465,7 +465,7 @@ func (e *fastEncL5Window) Encode(dst *tokens, src []byte) { // If the next long is a candidate, use that... t2 := lCandidate.Cur.offset - e.cur if nextS-t2 < maxMatchOffset { - if load3232(src, lCandidate.Cur.offset-e.cur) == uint32(next) { + if load3232(src, t2) == uint32(next) { ml := e.matchlen(nextS+4, t2+4, src) + 4 if ml > l { t = t2 @@ -476,7 +476,7 @@ func (e *fastEncL5Window) Encode(dst *tokens, src []byte) { } // If the previous long is a candidate, use that... t2 = lCandidate.Prev.offset - e.cur - if nextS-t2 < maxMatchOffset && load3232(src, lCandidate.Prev.offset-e.cur) == uint32(next) { + if nextS-t2 < maxMatchOffset && load3232(src, t2) == uint32(next) { ml := e.matchlen(nextS+4, t2+4, src) + 4 if ml > l { t = t2 diff --git a/vendor/github.com/klauspost/compress/flate/level6.go b/vendor/github.com/klauspost/compress/flate/level6.go index f1e9d98fa50..96f5bb430ad 100644 --- a/vendor/github.com/klauspost/compress/flate/level6.go +++ b/vendor/github.com/klauspost/compress/flate/level6.go @@ -113,7 +113,7 @@ func (e *fastEncL6) Encode(dst *tokens, src []byte) { t = lCandidate.Cur.offset - e.cur if s-t < maxMatchOffset { - if uint32(cv) == load3232(src, lCandidate.Cur.offset-e.cur) { + if uint32(cv) == load3232(src, t) { // Long candidate matches at least 4 bytes. // Store the next match @@ -123,9 +123,9 @@ func (e *fastEncL6) Encode(dst *tokens, src []byte) { // Check the previous long candidate as well. t2 := lCandidate.Prev.offset - e.cur - if s-t2 < maxMatchOffset && uint32(cv) == load3232(src, lCandidate.Prev.offset-e.cur) { - l = e.matchlen(s+4, t+4, src) + 4 - ml1 := e.matchlen(s+4, t2+4, src) + 4 + if s-t2 < maxMatchOffset && uint32(cv) == load3232(src, t2) { + l = e.matchlen(int(s+4), int(t+4), src) + 4 + ml1 := e.matchlen(int(s+4), int(t2+4), src) + 4 if ml1 > l { t = t2 l = ml1 @@ -136,7 +136,7 @@ func (e *fastEncL6) Encode(dst *tokens, src []byte) { } // Current value did not match, but check if previous long value does. t = lCandidate.Prev.offset - e.cur - if s-t < maxMatchOffset && uint32(cv) == load3232(src, lCandidate.Prev.offset-e.cur) { + if s-t < maxMatchOffset && uint32(cv) == load3232(src, t) { // Store the next match e.table[nextHashS] = tableEntry{offset: nextS + e.cur} eLong := &e.bTable[nextHashL] @@ -146,9 +146,9 @@ func (e *fastEncL6) Encode(dst *tokens, src []byte) { } t = sCandidate.offset - e.cur - if s-t < maxMatchOffset && uint32(cv) == load3232(src, sCandidate.offset-e.cur) { + if s-t < maxMatchOffset && uint32(cv) == load3232(src, t) { // Found a 4 match... - l = e.matchlen(s+4, t+4, src) + 4 + l = e.matchlen(int(s+4), int(t+4), src) + 4 // Look up next long candidate (at nextS) lCandidate = e.bTable[nextHashL] @@ -162,7 +162,7 @@ func (e *fastEncL6) Encode(dst *tokens, src []byte) { const repOff = 1 t2 := s - repeat + repOff if load3232(src, t2) == uint32(cv>>(8*repOff)) { - ml := e.matchlen(s+4+repOff, t2+4, src) + 4 + ml := e.matchlen(int(s+4+repOff), int(t2+4), src) + 4 if ml > l { t = t2 l = ml @@ -175,8 +175,8 @@ func (e *fastEncL6) Encode(dst *tokens, src []byte) { // If the next long is a candidate, use that... t2 = lCandidate.Cur.offset - e.cur if nextS-t2 < maxMatchOffset { - if load3232(src, lCandidate.Cur.offset-e.cur) == uint32(next) { - ml := e.matchlen(nextS+4, t2+4, src) + 4 + if load3232(src, t2) == uint32(next) { + ml := e.matchlen(int(nextS+4), int(t2+4), src) + 4 if ml > l { t = t2 s = nextS @@ -186,8 +186,8 @@ func (e *fastEncL6) Encode(dst *tokens, src []byte) { } // If the previous long is a candidate, use that... t2 = lCandidate.Prev.offset - e.cur - if nextS-t2 < maxMatchOffset && load3232(src, lCandidate.Prev.offset-e.cur) == uint32(next) { - ml := e.matchlen(nextS+4, t2+4, src) + 4 + if nextS-t2 < maxMatchOffset && load3232(src, t2) == uint32(next) { + ml := e.matchlen(int(nextS+4), int(t2+4), src) + 4 if ml > l { t = t2 s = nextS @@ -207,9 +207,9 @@ func (e *fastEncL6) Encode(dst *tokens, src []byte) { // Extend the 4-byte match as long as possible. if l == 0 { - l = e.matchlenLong(s+4, t+4, src) + 4 + l = e.matchlenLong(int(s+4), int(t+4), src) + 4 } else if l == maxMatchLength { - l += e.matchlenLong(s+l, t+l, src) + l += e.matchlenLong(int(s+l), int(t+l), src) } // Try to locate a better match by checking the end-of-match... @@ -227,7 +227,7 @@ func (e *fastEncL6) Encode(dst *tokens, src []byte) { off := s2 - t2 if off < maxMatchOffset { if off > 0 && t2 >= 0 { - if l2 := e.matchlenLong(s2, t2, src); l2 > l { + if l2 := e.matchlenLong(int(s2), int(t2), src); l2 > l { t = t2 l = l2 s = s2 @@ -237,7 +237,7 @@ func (e *fastEncL6) Encode(dst *tokens, src []byte) { t2 = eLong.Prev.offset - e.cur - l + skipBeginning off := s2 - t2 if off > 0 && off < maxMatchOffset && t2 >= 0 { - if l2 := e.matchlenLong(s2, t2, src); l2 > l { + if l2 := e.matchlenLong(int(s2), int(t2), src); l2 > l { t = t2 l = l2 s = s2 diff --git a/vendor/github.com/klauspost/compress/flate/matchlen_amd64.go b/vendor/github.com/klauspost/compress/flate/matchlen_amd64.go deleted file mode 100644 index 4bd3885841f..00000000000 --- a/vendor/github.com/klauspost/compress/flate/matchlen_amd64.go +++ /dev/null @@ -1,16 +0,0 @@ -//go:build amd64 && !appengine && !noasm && gc -// +build amd64,!appengine,!noasm,gc - -// Copyright 2019+ Klaus Post. All rights reserved. -// License information can be found in the LICENSE file. - -package flate - -// matchLen returns how many bytes match in a and b -// -// It assumes that: -// -// len(a) <= len(b) and len(a) > 0 -// -//go:noescape -func matchLen(a []byte, b []byte) int diff --git a/vendor/github.com/klauspost/compress/flate/matchlen_amd64.s b/vendor/github.com/klauspost/compress/flate/matchlen_amd64.s deleted file mode 100644 index 0782b86e3d1..00000000000 --- a/vendor/github.com/klauspost/compress/flate/matchlen_amd64.s +++ /dev/null @@ -1,66 +0,0 @@ -// Copied from S2 implementation. - -//go:build !appengine && !noasm && gc && !noasm - -#include "textflag.h" - -// func matchLen(a []byte, b []byte) int -TEXT ·matchLen(SB), NOSPLIT, $0-56 - MOVQ a_base+0(FP), AX - MOVQ b_base+24(FP), CX - MOVQ a_len+8(FP), DX - - // matchLen - XORL SI, SI - CMPL DX, $0x08 - JB matchlen_match4_standalone - -matchlen_loopback_standalone: - MOVQ (AX)(SI*1), BX - XORQ (CX)(SI*1), BX - JZ matchlen_loop_standalone - -#ifdef GOAMD64_v3 - TZCNTQ BX, BX -#else - BSFQ BX, BX -#endif - SHRL $0x03, BX - LEAL (SI)(BX*1), SI - JMP gen_match_len_end - -matchlen_loop_standalone: - LEAL -8(DX), DX - LEAL 8(SI), SI - CMPL DX, $0x08 - JAE matchlen_loopback_standalone - -matchlen_match4_standalone: - CMPL DX, $0x04 - JB matchlen_match2_standalone - MOVL (AX)(SI*1), BX - CMPL (CX)(SI*1), BX - JNE matchlen_match2_standalone - LEAL -4(DX), DX - LEAL 4(SI), SI - -matchlen_match2_standalone: - CMPL DX, $0x02 - JB matchlen_match1_standalone - MOVW (AX)(SI*1), BX - CMPW (CX)(SI*1), BX - JNE matchlen_match1_standalone - LEAL -2(DX), DX - LEAL 2(SI), SI - -matchlen_match1_standalone: - CMPL DX, $0x01 - JB gen_match_len_end - MOVB (AX)(SI*1), BL - CMPB (CX)(SI*1), BL - JNE gen_match_len_end - INCL SI - -gen_match_len_end: - MOVQ SI, ret+48(FP) - RET diff --git a/vendor/github.com/klauspost/compress/flate/matchlen_generic.go b/vendor/github.com/klauspost/compress/flate/matchlen_generic.go index ad5cd814b91..6149384aaf9 100644 --- a/vendor/github.com/klauspost/compress/flate/matchlen_generic.go +++ b/vendor/github.com/klauspost/compress/flate/matchlen_generic.go @@ -1,27 +1,29 @@ -//go:build !amd64 || appengine || !gc || noasm -// +build !amd64 appengine !gc noasm - // Copyright 2019+ Klaus Post. All rights reserved. // License information can be found in the LICENSE file. package flate import ( - "encoding/binary" "math/bits" + + "github.com/klauspost/compress/internal/le" ) // matchLen returns the maximum common prefix length of a and b. // a must be the shortest of the two. func matchLen(a, b []byte) (n int) { - for ; len(a) >= 8 && len(b) >= 8; a, b = a[8:], b[8:] { - diff := binary.LittleEndian.Uint64(a) ^ binary.LittleEndian.Uint64(b) + left := len(a) + for left >= 8 { + diff := le.Load64(a, n) ^ le.Load64(b, n) if diff != 0 { return n + bits.TrailingZeros64(diff)>>3 } n += 8 + left -= 8 } + a = a[n:] + b = b[n:] for i := range a { if a[i] != b[i] { break @@ -29,5 +31,4 @@ func matchLen(a, b []byte) (n int) { n++ } return n - } diff --git a/vendor/github.com/klauspost/compress/flate/stateless.go b/vendor/github.com/klauspost/compress/flate/stateless.go index f3d4139ef36..13b9b100dbc 100644 --- a/vendor/github.com/klauspost/compress/flate/stateless.go +++ b/vendor/github.com/klauspost/compress/flate/stateless.go @@ -4,6 +4,8 @@ import ( "io" "math" "sync" + + "github.com/klauspost/compress/internal/le" ) const ( @@ -152,18 +154,11 @@ func hashSL(u uint32) uint32 { } func load3216(b []byte, i int16) uint32 { - // Help the compiler eliminate bounds checks on the read so it can be done in a single read. - b = b[i:] - b = b[:4] - return uint32(b[0]) | uint32(b[1])<<8 | uint32(b[2])<<16 | uint32(b[3])<<24 + return le.Load32(b, i) } func load6416(b []byte, i int16) uint64 { - // Help the compiler eliminate bounds checks on the read so it can be done in a single read. - b = b[i:] - b = b[:8] - return uint64(b[0]) | uint64(b[1])<<8 | uint64(b[2])<<16 | uint64(b[3])<<24 | - uint64(b[4])<<32 | uint64(b[5])<<40 | uint64(b[6])<<48 | uint64(b[7])<<56 + return le.Load64(b, i) } func statelessEnc(dst *tokens, src []byte, startAt int16) { diff --git a/vendor/github.com/klauspost/compress/huff0/bitreader.go b/vendor/github.com/klauspost/compress/huff0/bitreader.go index e36d9742f94..bfc7a523dee 100644 --- a/vendor/github.com/klauspost/compress/huff0/bitreader.go +++ b/vendor/github.com/klauspost/compress/huff0/bitreader.go @@ -6,10 +6,11 @@ package huff0 import ( - "encoding/binary" "errors" "fmt" "io" + + "github.com/klauspost/compress/internal/le" ) // bitReader reads a bitstream in reverse. @@ -46,7 +47,7 @@ func (b *bitReaderBytes) init(in []byte) error { return nil } -// peekBitsFast requires that at least one bit is requested every time. +// peekByteFast requires that at least one byte is requested every time. // There are no checks if the buffer is filled. func (b *bitReaderBytes) peekByteFast() uint8 { got := uint8(b.value >> 56) @@ -66,8 +67,7 @@ func (b *bitReaderBytes) fillFast() { } // 2 bounds checks. - v := b.in[b.off-4 : b.off] - low := (uint32(v[0])) | (uint32(v[1]) << 8) | (uint32(v[2]) << 16) | (uint32(v[3]) << 24) + low := le.Load32(b.in, b.off-4) b.value |= uint64(low) << (b.bitsRead - 32) b.bitsRead -= 32 b.off -= 4 @@ -76,7 +76,7 @@ func (b *bitReaderBytes) fillFast() { // fillFastStart() assumes the bitReaderBytes is empty and there is at least 8 bytes to read. func (b *bitReaderBytes) fillFastStart() { // Do single re-slice to avoid bounds checks. - b.value = binary.LittleEndian.Uint64(b.in[b.off-8:]) + b.value = le.Load64(b.in, b.off-8) b.bitsRead = 0 b.off -= 8 } @@ -86,9 +86,8 @@ func (b *bitReaderBytes) fill() { if b.bitsRead < 32 { return } - if b.off > 4 { - v := b.in[b.off-4 : b.off] - low := (uint32(v[0])) | (uint32(v[1]) << 8) | (uint32(v[2]) << 16) | (uint32(v[3]) << 24) + if b.off >= 4 { + low := le.Load32(b.in, b.off-4) b.value |= uint64(low) << (b.bitsRead - 32) b.bitsRead -= 32 b.off -= 4 @@ -175,9 +174,7 @@ func (b *bitReaderShifted) fillFast() { return } - // 2 bounds checks. - v := b.in[b.off-4 : b.off] - low := (uint32(v[0])) | (uint32(v[1]) << 8) | (uint32(v[2]) << 16) | (uint32(v[3]) << 24) + low := le.Load32(b.in, b.off-4) b.value |= uint64(low) << ((b.bitsRead - 32) & 63) b.bitsRead -= 32 b.off -= 4 @@ -185,8 +182,7 @@ func (b *bitReaderShifted) fillFast() { // fillFastStart() assumes the bitReaderShifted is empty and there is at least 8 bytes to read. func (b *bitReaderShifted) fillFastStart() { - // Do single re-slice to avoid bounds checks. - b.value = binary.LittleEndian.Uint64(b.in[b.off-8:]) + b.value = le.Load64(b.in, b.off-8) b.bitsRead = 0 b.off -= 8 } @@ -197,8 +193,7 @@ func (b *bitReaderShifted) fill() { return } if b.off > 4 { - v := b.in[b.off-4 : b.off] - low := (uint32(v[0])) | (uint32(v[1]) << 8) | (uint32(v[2]) << 16) | (uint32(v[3]) << 24) + low := le.Load32(b.in, b.off-4) b.value |= uint64(low) << ((b.bitsRead - 32) & 63) b.bitsRead -= 32 b.off -= 4 diff --git a/vendor/github.com/klauspost/compress/internal/le/le.go b/vendor/github.com/klauspost/compress/internal/le/le.go new file mode 100644 index 00000000000..e54909e16fc --- /dev/null +++ b/vendor/github.com/klauspost/compress/internal/le/le.go @@ -0,0 +1,5 @@ +package le + +type Indexer interface { + int | int8 | int16 | int32 | int64 | uint | uint8 | uint16 | uint32 | uint64 +} diff --git a/vendor/github.com/klauspost/compress/internal/le/unsafe_disabled.go b/vendor/github.com/klauspost/compress/internal/le/unsafe_disabled.go new file mode 100644 index 00000000000..0cfb5c0e278 --- /dev/null +++ b/vendor/github.com/klauspost/compress/internal/le/unsafe_disabled.go @@ -0,0 +1,42 @@ +//go:build !(amd64 || arm64 || ppc64le || riscv64) || nounsafe || purego || appengine + +package le + +import ( + "encoding/binary" +) + +// Load8 will load from b at index i. +func Load8[I Indexer](b []byte, i I) byte { + return b[i] +} + +// Load16 will load from b at index i. +func Load16[I Indexer](b []byte, i I) uint16 { + return binary.LittleEndian.Uint16(b[i:]) +} + +// Load32 will load from b at index i. +func Load32[I Indexer](b []byte, i I) uint32 { + return binary.LittleEndian.Uint32(b[i:]) +} + +// Load64 will load from b at index i. +func Load64[I Indexer](b []byte, i I) uint64 { + return binary.LittleEndian.Uint64(b[i:]) +} + +// Store16 will store v at b. +func Store16(b []byte, v uint16) { + binary.LittleEndian.PutUint16(b, v) +} + +// Store32 will store v at b. +func Store32(b []byte, v uint32) { + binary.LittleEndian.PutUint32(b, v) +} + +// Store64 will store v at b. +func Store64(b []byte, v uint64) { + binary.LittleEndian.PutUint64(b, v) +} diff --git a/vendor/github.com/klauspost/compress/internal/le/unsafe_enabled.go b/vendor/github.com/klauspost/compress/internal/le/unsafe_enabled.go new file mode 100644 index 00000000000..ada45cd909e --- /dev/null +++ b/vendor/github.com/klauspost/compress/internal/le/unsafe_enabled.go @@ -0,0 +1,55 @@ +// We enable 64 bit LE platforms: + +//go:build (amd64 || arm64 || ppc64le || riscv64) && !nounsafe && !purego && !appengine + +package le + +import ( + "unsafe" +) + +// Load8 will load from b at index i. +func Load8[I Indexer](b []byte, i I) byte { + //return binary.LittleEndian.Uint16(b[i:]) + //return *(*uint16)(unsafe.Pointer(&b[i])) + return *(*byte)(unsafe.Add(unsafe.Pointer(unsafe.SliceData(b)), i)) +} + +// Load16 will load from b at index i. +func Load16[I Indexer](b []byte, i I) uint16 { + //return binary.LittleEndian.Uint16(b[i:]) + //return *(*uint16)(unsafe.Pointer(&b[i])) + return *(*uint16)(unsafe.Add(unsafe.Pointer(unsafe.SliceData(b)), i)) +} + +// Load32 will load from b at index i. +func Load32[I Indexer](b []byte, i I) uint32 { + //return binary.LittleEndian.Uint32(b[i:]) + //return *(*uint32)(unsafe.Pointer(&b[i])) + return *(*uint32)(unsafe.Add(unsafe.Pointer(unsafe.SliceData(b)), i)) +} + +// Load64 will load from b at index i. +func Load64[I Indexer](b []byte, i I) uint64 { + //return binary.LittleEndian.Uint64(b[i:]) + //return *(*uint64)(unsafe.Pointer(&b[i])) + return *(*uint64)(unsafe.Add(unsafe.Pointer(unsafe.SliceData(b)), i)) +} + +// Store16 will store v at b. +func Store16(b []byte, v uint16) { + //binary.LittleEndian.PutUint16(b, v) + *(*uint16)(unsafe.Pointer(unsafe.SliceData(b))) = v +} + +// Store32 will store v at b. +func Store32(b []byte, v uint32) { + //binary.LittleEndian.PutUint32(b, v) + *(*uint32)(unsafe.Pointer(unsafe.SliceData(b))) = v +} + +// Store64 will store v at b. +func Store64(b []byte, v uint64) { + //binary.LittleEndian.PutUint64(b, v) + *(*uint64)(unsafe.Pointer(unsafe.SliceData(b))) = v +} diff --git a/vendor/github.com/klauspost/compress/s2/README.md b/vendor/github.com/klauspost/compress/s2/README.md index 8284bb0810c..1d9220cbf56 100644 --- a/vendor/github.com/klauspost/compress/s2/README.md +++ b/vendor/github.com/klauspost/compress/s2/README.md @@ -79,7 +79,7 @@ This will take ownership of the buffer until the stream is closed. func EncodeStream(src []byte, dst io.Writer) error { enc := s2.NewWriter(dst) // The encoder owns the buffer until Flush or Close is called. - err := enc.EncodeBuffer(buf) + err := enc.EncodeBuffer(src) if err != nil { enc.Close() return err diff --git a/vendor/github.com/klauspost/compress/s2/decode_other.go b/vendor/github.com/klauspost/compress/s2/decode_other.go index 2cb55c2c775..c99d40b69d0 100644 --- a/vendor/github.com/klauspost/compress/s2/decode_other.go +++ b/vendor/github.com/klauspost/compress/s2/decode_other.go @@ -11,6 +11,8 @@ package s2 import ( "fmt" "strconv" + + "github.com/klauspost/compress/internal/le" ) // decode writes the decoding of src to dst. It assumes that the varint-encoded @@ -38,21 +40,18 @@ func s2Decode(dst, src []byte) int { case x < 60: s++ case x == 60: + x = uint32(src[s+1]) s += 2 - x = uint32(src[s-1]) case x == 61: - in := src[s : s+3] - x = uint32(in[1]) | uint32(in[2])<<8 + x = uint32(le.Load16(src, s+1)) s += 3 case x == 62: - in := src[s : s+4] // Load as 32 bit and shift down. - x = uint32(in[0]) | uint32(in[1])<<8 | uint32(in[2])<<16 | uint32(in[3])<<24 + x = le.Load32(src, s) x >>= 8 s += 4 case x == 63: - in := src[s : s+5] - x = uint32(in[1]) | uint32(in[2])<<8 | uint32(in[3])<<16 | uint32(in[4])<<24 + x = le.Load32(src, s+1) s += 5 } length = int(x) + 1 @@ -85,8 +84,7 @@ func s2Decode(dst, src []byte) int { length = int(src[s]) + 4 s += 1 case 6: - in := src[s : s+2] - length = int(uint32(in[0])|(uint32(in[1])<<8)) + (1 << 8) + length = int(le.Load16(src, s)) + 1<<8 s += 2 case 7: in := src[s : s+3] @@ -99,15 +97,13 @@ func s2Decode(dst, src []byte) int { } length += 4 case tagCopy2: - in := src[s : s+3] - offset = int(uint32(in[1]) | uint32(in[2])<<8) - length = 1 + int(in[0])>>2 + offset = int(le.Load16(src, s+1)) + length = 1 + int(src[s])>>2 s += 3 case tagCopy4: - in := src[s : s+5] - offset = int(uint32(in[1]) | uint32(in[2])<<8 | uint32(in[3])<<16 | uint32(in[4])<<24) - length = 1 + int(in[0])>>2 + offset = int(le.Load32(src, s+1)) + length = 1 + int(src[s])>>2 s += 5 } diff --git a/vendor/github.com/klauspost/compress/s2/encode_all.go b/vendor/github.com/klauspost/compress/s2/encode_all.go index 99770456968..a473b645291 100644 --- a/vendor/github.com/klauspost/compress/s2/encode_all.go +++ b/vendor/github.com/klauspost/compress/s2/encode_all.go @@ -10,14 +10,16 @@ import ( "encoding/binary" "fmt" "math/bits" + + "github.com/klauspost/compress/internal/le" ) func load32(b []byte, i int) uint32 { - return binary.LittleEndian.Uint32(b[i:]) + return le.Load32(b, i) } func load64(b []byte, i int) uint64 { - return binary.LittleEndian.Uint64(b[i:]) + return le.Load64(b, i) } // hash6 returns the hash of the lowest 6 bytes of u to fit in a hash table with h bits. @@ -44,7 +46,12 @@ func encodeGo(dst, src []byte) []byte { d += emitLiteral(dst[d:], src) return dst[:d] } - n := encodeBlockGo(dst[d:], src) + var n int + if len(src) < 64<<10 { + n = encodeBlockGo64K(dst[d:], src) + } else { + n = encodeBlockGo(dst[d:], src) + } if n > 0 { d += n return dst[:d] @@ -70,7 +77,6 @@ func encodeBlockGo(dst, src []byte) (d int) { debug = false ) - var table [maxTableSize]uint32 // sLimit is when to stop looking for offset/length copies. The inputMargin @@ -277,13 +283,228 @@ emitRemainder: return d } -func encodeBlockSnappyGo(dst, src []byte) (d int) { +// encodeBlockGo64K is a specialized version for compressing blocks <= 64KB +func encodeBlockGo64K(dst, src []byte) (d int) { // Initialize the hash table. const ( tableBits = 14 maxTableSize = 1 << tableBits + + debug = false ) + var table [maxTableSize]uint16 + + // sLimit is when to stop looking for offset/length copies. The inputMargin + // lets us use a fast path for emitLiteral in the main loop, while we are + // looking for copies. + sLimit := len(src) - inputMargin + + // Bail if we can't compress to at least this. + dstLimit := len(src) - len(src)>>5 - 5 + + // nextEmit is where in src the next emitLiteral should start from. + nextEmit := 0 + + // The encoded form must start with a literal, as there are no previous + // bytes to copy, so we start looking for hash matches at s == 1. + s := 1 + cv := load64(src, s) + + // We search for a repeat at -1, but don't output repeats when nextEmit == 0 + repeat := 1 + + for { + candidate := 0 + for { + // Next src position to check + nextS := s + (s-nextEmit)>>5 + 4 + if nextS > sLimit { + goto emitRemainder + } + hash0 := hash6(cv, tableBits) + hash1 := hash6(cv>>8, tableBits) + candidate = int(table[hash0]) + candidate2 := int(table[hash1]) + table[hash0] = uint16(s) + table[hash1] = uint16(s + 1) + hash2 := hash6(cv>>16, tableBits) + + // Check repeat at offset checkRep. + const checkRep = 1 + if uint32(cv>>(checkRep*8)) == load32(src, s-repeat+checkRep) { + base := s + checkRep + // Extend back + for i := base - repeat; base > nextEmit && i > 0 && src[i-1] == src[base-1]; { + i-- + base-- + } + + // Bail if we exceed the maximum size. + if d+(base-nextEmit) > dstLimit { + return 0 + } + + d += emitLiteral(dst[d:], src[nextEmit:base]) + + // Extend forward + candidate := s - repeat + 4 + checkRep + s += 4 + checkRep + for s <= sLimit { + if diff := load64(src, s) ^ load64(src, candidate); diff != 0 { + s += bits.TrailingZeros64(diff) >> 3 + break + } + s += 8 + candidate += 8 + } + if debug { + // Validate match. + if s <= candidate { + panic("s <= candidate") + } + a := src[base:s] + b := src[base-repeat : base-repeat+(s-base)] + if !bytes.Equal(a, b) { + panic("mismatch") + } + } + if nextEmit > 0 { + // same as `add := emitCopy(dst[d:], repeat, s-base)` but skips storing offset. + d += emitRepeat(dst[d:], repeat, s-base) + } else { + // First match, cannot be repeat. + d += emitCopy(dst[d:], repeat, s-base) + } + nextEmit = s + if s >= sLimit { + goto emitRemainder + } + cv = load64(src, s) + continue + } + + if uint32(cv) == load32(src, candidate) { + break + } + candidate = int(table[hash2]) + if uint32(cv>>8) == load32(src, candidate2) { + table[hash2] = uint16(s + 2) + candidate = candidate2 + s++ + break + } + table[hash2] = uint16(s + 2) + if uint32(cv>>16) == load32(src, candidate) { + s += 2 + break + } + + cv = load64(src, nextS) + s = nextS + } + + // Extend backwards. + // The top bytes will be rechecked to get the full match. + for candidate > 0 && s > nextEmit && src[candidate-1] == src[s-1] { + candidate-- + s-- + } + + // Bail if we exceed the maximum size. + if d+(s-nextEmit) > dstLimit { + return 0 + } + + // A 4-byte match has been found. We'll later see if more than 4 bytes + // match. But, prior to the match, src[nextEmit:s] are unmatched. Emit + // them as literal bytes. + + d += emitLiteral(dst[d:], src[nextEmit:s]) + + // Call emitCopy, and then see if another emitCopy could be our next + // move. Repeat until we find no match for the input immediately after + // what was consumed by the last emitCopy call. + // + // If we exit this loop normally then we need to call emitLiteral next, + // though we don't yet know how big the literal will be. We handle that + // by proceeding to the next iteration of the main loop. We also can + // exit this loop via goto if we get close to exhausting the input. + for { + // Invariant: we have a 4-byte match at s, and no need to emit any + // literal bytes prior to s. + base := s + repeat = base - candidate + + // Extend the 4-byte match as long as possible. + s += 4 + candidate += 4 + for s <= len(src)-8 { + if diff := load64(src, s) ^ load64(src, candidate); diff != 0 { + s += bits.TrailingZeros64(diff) >> 3 + break + } + s += 8 + candidate += 8 + } + + d += emitCopy(dst[d:], repeat, s-base) + if debug { + // Validate match. + if s <= candidate { + panic("s <= candidate") + } + a := src[base:s] + b := src[base-repeat : base-repeat+(s-base)] + if !bytes.Equal(a, b) { + panic("mismatch") + } + } + + nextEmit = s + if s >= sLimit { + goto emitRemainder + } + + if d > dstLimit { + // Do we have space for more, if not bail. + return 0 + } + // Check for an immediate match, otherwise start search at s+1 + x := load64(src, s-2) + m2Hash := hash6(x, tableBits) + currHash := hash6(x>>16, tableBits) + candidate = int(table[currHash]) + table[m2Hash] = uint16(s - 2) + table[currHash] = uint16(s) + if debug && s == candidate { + panic("s == candidate") + } + if uint32(x>>16) != load32(src, candidate) { + cv = load64(src, s+1) + s++ + break + } + } + } + +emitRemainder: + if nextEmit < len(src) { + // Bail if we exceed the maximum size. + if d+len(src)-nextEmit > dstLimit { + return 0 + } + d += emitLiteral(dst[d:], src[nextEmit:]) + } + return d +} + +func encodeBlockSnappyGo(dst, src []byte) (d int) { + // Initialize the hash table. + const ( + tableBits = 14 + maxTableSize = 1 << tableBits + ) var table [maxTableSize]uint32 // sLimit is when to stop looking for offset/length copies. The inputMargin @@ -467,6 +688,197 @@ emitRemainder: return d } +// encodeBlockSnappyGo64K is a special version of encodeBlockSnappyGo for sizes <64KB +func encodeBlockSnappyGo64K(dst, src []byte) (d int) { + // Initialize the hash table. + const ( + tableBits = 14 + maxTableSize = 1 << tableBits + ) + + var table [maxTableSize]uint16 + + // sLimit is when to stop looking for offset/length copies. The inputMargin + // lets us use a fast path for emitLiteral in the main loop, while we are + // looking for copies. + sLimit := len(src) - inputMargin + + // Bail if we can't compress to at least this. + dstLimit := len(src) - len(src)>>5 - 5 + + // nextEmit is where in src the next emitLiteral should start from. + nextEmit := 0 + + // The encoded form must start with a literal, as there are no previous + // bytes to copy, so we start looking for hash matches at s == 1. + s := 1 + cv := load64(src, s) + + // We search for a repeat at -1, but don't output repeats when nextEmit == 0 + repeat := 1 + + for { + candidate := 0 + for { + // Next src position to check + nextS := s + (s-nextEmit)>>5 + 4 + if nextS > sLimit { + goto emitRemainder + } + hash0 := hash6(cv, tableBits) + hash1 := hash6(cv>>8, tableBits) + candidate = int(table[hash0]) + candidate2 := int(table[hash1]) + table[hash0] = uint16(s) + table[hash1] = uint16(s + 1) + hash2 := hash6(cv>>16, tableBits) + + // Check repeat at offset checkRep. + const checkRep = 1 + if uint32(cv>>(checkRep*8)) == load32(src, s-repeat+checkRep) { + base := s + checkRep + // Extend back + for i := base - repeat; base > nextEmit && i > 0 && src[i-1] == src[base-1]; { + i-- + base-- + } + // Bail if we exceed the maximum size. + if d+(base-nextEmit) > dstLimit { + return 0 + } + + d += emitLiteral(dst[d:], src[nextEmit:base]) + + // Extend forward + candidate := s - repeat + 4 + checkRep + s += 4 + checkRep + for s <= sLimit { + if diff := load64(src, s) ^ load64(src, candidate); diff != 0 { + s += bits.TrailingZeros64(diff) >> 3 + break + } + s += 8 + candidate += 8 + } + + d += emitCopyNoRepeat(dst[d:], repeat, s-base) + nextEmit = s + if s >= sLimit { + goto emitRemainder + } + + cv = load64(src, s) + continue + } + + if uint32(cv) == load32(src, candidate) { + break + } + candidate = int(table[hash2]) + if uint32(cv>>8) == load32(src, candidate2) { + table[hash2] = uint16(s + 2) + candidate = candidate2 + s++ + break + } + table[hash2] = uint16(s + 2) + if uint32(cv>>16) == load32(src, candidate) { + s += 2 + break + } + + cv = load64(src, nextS) + s = nextS + } + + // Extend backwards + for candidate > 0 && s > nextEmit && src[candidate-1] == src[s-1] { + candidate-- + s-- + } + + // Bail if we exceed the maximum size. + if d+(s-nextEmit) > dstLimit { + return 0 + } + + // A 4-byte match has been found. We'll later see if more than 4 bytes + // match. But, prior to the match, src[nextEmit:s] are unmatched. Emit + // them as literal bytes. + + d += emitLiteral(dst[d:], src[nextEmit:s]) + + // Call emitCopy, and then see if another emitCopy could be our next + // move. Repeat until we find no match for the input immediately after + // what was consumed by the last emitCopy call. + // + // If we exit this loop normally then we need to call emitLiteral next, + // though we don't yet know how big the literal will be. We handle that + // by proceeding to the next iteration of the main loop. We also can + // exit this loop via goto if we get close to exhausting the input. + for { + // Invariant: we have a 4-byte match at s, and no need to emit any + // literal bytes prior to s. + base := s + repeat = base - candidate + + // Extend the 4-byte match as long as possible. + s += 4 + candidate += 4 + for s <= len(src)-8 { + if diff := load64(src, s) ^ load64(src, candidate); diff != 0 { + s += bits.TrailingZeros64(diff) >> 3 + break + } + s += 8 + candidate += 8 + } + + d += emitCopyNoRepeat(dst[d:], repeat, s-base) + if false { + // Validate match. + a := src[base:s] + b := src[base-repeat : base-repeat+(s-base)] + if !bytes.Equal(a, b) { + panic("mismatch") + } + } + + nextEmit = s + if s >= sLimit { + goto emitRemainder + } + + if d > dstLimit { + // Do we have space for more, if not bail. + return 0 + } + // Check for an immediate match, otherwise start search at s+1 + x := load64(src, s-2) + m2Hash := hash6(x, tableBits) + currHash := hash6(x>>16, tableBits) + candidate = int(table[currHash]) + table[m2Hash] = uint16(s - 2) + table[currHash] = uint16(s) + if uint32(x>>16) != load32(src, candidate) { + cv = load64(src, s+1) + s++ + break + } + } + } + +emitRemainder: + if nextEmit < len(src) { + // Bail if we exceed the maximum size. + if d+len(src)-nextEmit > dstLimit { + return 0 + } + d += emitLiteral(dst[d:], src[nextEmit:]) + } + return d +} + // encodeBlockGo encodes a non-empty src to a guaranteed-large-enough dst. It // assumes that the varint-encoded length of the decompressed bytes has already // been written. diff --git a/vendor/github.com/klauspost/compress/s2/encode_better.go b/vendor/github.com/klauspost/compress/s2/encode_better.go index 544cb1e17b9..90ebf89c204 100644 --- a/vendor/github.com/klauspost/compress/s2/encode_better.go +++ b/vendor/github.com/klauspost/compress/s2/encode_better.go @@ -348,12 +348,7 @@ func encodeBlockBetterSnappyGo(dst, src []byte) (d int) { nextS := 0 for { // Next src position to check - nextS = (s-nextEmit)>>7 + 1 - if nextS > maxSkip { - nextS = s + maxSkip - } else { - nextS += s - } + nextS = min(s+(s-nextEmit)>>7+1, s+maxSkip) if nextS > sLimit { goto emitRemainder @@ -483,6 +478,415 @@ emitRemainder: return d } +func encodeBlockBetterGo64K(dst, src []byte) (d int) { + // sLimit is when to stop looking for offset/length copies. The inputMargin + // lets us use a fast path for emitLiteral in the main loop, while we are + // looking for copies. + sLimit := len(src) - inputMargin + if len(src) < minNonLiteralBlockSize { + return 0 + } + // Initialize the hash tables. + // Use smaller tables for smaller blocks + const ( + // Long hash matches. + lTableBits = 16 + maxLTableSize = 1 << lTableBits + + // Short hash matches. + sTableBits = 13 + maxSTableSize = 1 << sTableBits + ) + + var lTable [maxLTableSize]uint16 + var sTable [maxSTableSize]uint16 + + // Bail if we can't compress to at least this. + dstLimit := len(src) - len(src)>>5 - 6 + + // nextEmit is where in src the next emitLiteral should start from. + nextEmit := 0 + + // The encoded form must start with a literal, as there are no previous + // bytes to copy, so we start looking for hash matches at s == 1. + s := 1 + cv := load64(src, s) + + // We initialize repeat to 0, so we never match on first attempt + repeat := 0 + + for { + candidateL := 0 + nextS := 0 + for { + // Next src position to check + nextS = s + (s-nextEmit)>>6 + 1 + if nextS > sLimit { + goto emitRemainder + } + hashL := hash7(cv, lTableBits) + hashS := hash4(cv, sTableBits) + candidateL = int(lTable[hashL]) + candidateS := int(sTable[hashS]) + lTable[hashL] = uint16(s) + sTable[hashS] = uint16(s) + + valLong := load64(src, candidateL) + valShort := load64(src, candidateS) + + // If long matches at least 8 bytes, use that. + if cv == valLong { + break + } + if cv == valShort { + candidateL = candidateS + break + } + + // Check repeat at offset checkRep. + const checkRep = 1 + // Minimum length of a repeat. Tested with various values. + // While 4-5 offers improvements in some, 6 reduces + // regressions significantly. + const wantRepeatBytes = 6 + const repeatMask = ((1 << (wantRepeatBytes * 8)) - 1) << (8 * checkRep) + if false && repeat > 0 && cv&repeatMask == load64(src, s-repeat)&repeatMask { + base := s + checkRep + // Extend back + for i := base - repeat; base > nextEmit && i > 0 && src[i-1] == src[base-1]; { + i-- + base-- + } + d += emitLiteral(dst[d:], src[nextEmit:base]) + + // Extend forward + candidate := s - repeat + wantRepeatBytes + checkRep + s += wantRepeatBytes + checkRep + for s < len(src) { + if len(src)-s < 8 { + if src[s] == src[candidate] { + s++ + candidate++ + continue + } + break + } + if diff := load64(src, s) ^ load64(src, candidate); diff != 0 { + s += bits.TrailingZeros64(diff) >> 3 + break + } + s += 8 + candidate += 8 + } + // same as `add := emitCopy(dst[d:], repeat, s-base)` but skips storing offset. + d += emitRepeat(dst[d:], repeat, s-base) + nextEmit = s + if s >= sLimit { + goto emitRemainder + } + // Index in-between + index0 := base + 1 + index1 := s - 2 + + for index0 < index1 { + cv0 := load64(src, index0) + cv1 := load64(src, index1) + lTable[hash7(cv0, lTableBits)] = uint16(index0) + sTable[hash4(cv0>>8, sTableBits)] = uint16(index0 + 1) + + lTable[hash7(cv1, lTableBits)] = uint16(index1) + sTable[hash4(cv1>>8, sTableBits)] = uint16(index1 + 1) + index0 += 2 + index1 -= 2 + } + + cv = load64(src, s) + continue + } + + // Long likely matches 7, so take that. + if uint32(cv) == uint32(valLong) { + break + } + + // Check our short candidate + if uint32(cv) == uint32(valShort) { + // Try a long candidate at s+1 + hashL = hash7(cv>>8, lTableBits) + candidateL = int(lTable[hashL]) + lTable[hashL] = uint16(s + 1) + if uint32(cv>>8) == load32(src, candidateL) { + s++ + break + } + // Use our short candidate. + candidateL = candidateS + break + } + + cv = load64(src, nextS) + s = nextS + } + + // Extend backwards + for candidateL > 0 && s > nextEmit && src[candidateL-1] == src[s-1] { + candidateL-- + s-- + } + + // Bail if we exceed the maximum size. + if d+(s-nextEmit) > dstLimit { + return 0 + } + + base := s + offset := base - candidateL + + // Extend the 4-byte match as long as possible. + s += 4 + candidateL += 4 + for s < len(src) { + if len(src)-s < 8 { + if src[s] == src[candidateL] { + s++ + candidateL++ + continue + } + break + } + if diff := load64(src, s) ^ load64(src, candidateL); diff != 0 { + s += bits.TrailingZeros64(diff) >> 3 + break + } + s += 8 + candidateL += 8 + } + + d += emitLiteral(dst[d:], src[nextEmit:base]) + if repeat == offset { + d += emitRepeat(dst[d:], offset, s-base) + } else { + d += emitCopy(dst[d:], offset, s-base) + repeat = offset + } + + nextEmit = s + if s >= sLimit { + goto emitRemainder + } + + if d > dstLimit { + // Do we have space for more, if not bail. + return 0 + } + + // Index short & long + index0 := base + 1 + index1 := s - 2 + + cv0 := load64(src, index0) + cv1 := load64(src, index1) + lTable[hash7(cv0, lTableBits)] = uint16(index0) + sTable[hash4(cv0>>8, sTableBits)] = uint16(index0 + 1) + + // lTable could be postponed, but very minor difference. + lTable[hash7(cv1, lTableBits)] = uint16(index1) + sTable[hash4(cv1>>8, sTableBits)] = uint16(index1 + 1) + index0 += 1 + index1 -= 1 + cv = load64(src, s) + + // Index large values sparsely in between. + // We do two starting from different offsets for speed. + index2 := (index0 + index1 + 1) >> 1 + for index2 < index1 { + lTable[hash7(load64(src, index0), lTableBits)] = uint16(index0) + lTable[hash7(load64(src, index2), lTableBits)] = uint16(index2) + index0 += 2 + index2 += 2 + } + } + +emitRemainder: + if nextEmit < len(src) { + // Bail if we exceed the maximum size. + if d+len(src)-nextEmit > dstLimit { + return 0 + } + d += emitLiteral(dst[d:], src[nextEmit:]) + } + return d +} + +// encodeBlockBetterSnappyGo encodes a non-empty src to a guaranteed-large-enough dst. It +// assumes that the varint-encoded length of the decompressed bytes has already +// been written. +// +// It also assumes that: +// +// len(dst) >= MaxEncodedLen(len(src)) && +// minNonLiteralBlockSize <= len(src) && len(src) <= maxBlockSize +func encodeBlockBetterSnappyGo64K(dst, src []byte) (d int) { + // sLimit is when to stop looking for offset/length copies. The inputMargin + // lets us use a fast path for emitLiteral in the main loop, while we are + // looking for copies. + sLimit := len(src) - inputMargin + if len(src) < minNonLiteralBlockSize { + return 0 + } + + // Initialize the hash tables. + // Use smaller tables for smaller blocks + const ( + // Long hash matches. + lTableBits = 15 + maxLTableSize = 1 << lTableBits + + // Short hash matches. + sTableBits = 13 + maxSTableSize = 1 << sTableBits + ) + + var lTable [maxLTableSize]uint16 + var sTable [maxSTableSize]uint16 + + // Bail if we can't compress to at least this. + dstLimit := len(src) - len(src)>>5 - 6 + + // nextEmit is where in src the next emitLiteral should start from. + nextEmit := 0 + + // The encoded form must start with a literal, as there are no previous + // bytes to copy, so we start looking for hash matches at s == 1. + s := 1 + cv := load64(src, s) + + const maxSkip = 100 + + for { + candidateL := 0 + nextS := 0 + for { + // Next src position to check + nextS = min(s+(s-nextEmit)>>6+1, s+maxSkip) + + if nextS > sLimit { + goto emitRemainder + } + hashL := hash7(cv, lTableBits) + hashS := hash4(cv, sTableBits) + candidateL = int(lTable[hashL]) + candidateS := int(sTable[hashS]) + lTable[hashL] = uint16(s) + sTable[hashS] = uint16(s) + + if uint32(cv) == load32(src, candidateL) { + break + } + + // Check our short candidate + if uint32(cv) == load32(src, candidateS) { + // Try a long candidate at s+1 + hashL = hash7(cv>>8, lTableBits) + candidateL = int(lTable[hashL]) + lTable[hashL] = uint16(s + 1) + if uint32(cv>>8) == load32(src, candidateL) { + s++ + break + } + // Use our short candidate. + candidateL = candidateS + break + } + + cv = load64(src, nextS) + s = nextS + } + + // Extend backwards + for candidateL > 0 && s > nextEmit && src[candidateL-1] == src[s-1] { + candidateL-- + s-- + } + + // Bail if we exceed the maximum size. + if d+(s-nextEmit) > dstLimit { + return 0 + } + + base := s + offset := base - candidateL + + // Extend the 4-byte match as long as possible. + s += 4 + candidateL += 4 + for s < len(src) { + if len(src)-s < 8 { + if src[s] == src[candidateL] { + s++ + candidateL++ + continue + } + break + } + if diff := load64(src, s) ^ load64(src, candidateL); diff != 0 { + s += bits.TrailingZeros64(diff) >> 3 + break + } + s += 8 + candidateL += 8 + } + + d += emitLiteral(dst[d:], src[nextEmit:base]) + d += emitCopyNoRepeat(dst[d:], offset, s-base) + + nextEmit = s + if s >= sLimit { + goto emitRemainder + } + + if d > dstLimit { + // Do we have space for more, if not bail. + return 0 + } + + // Index short & long + index0 := base + 1 + index1 := s - 2 + + cv0 := load64(src, index0) + cv1 := load64(src, index1) + lTable[hash7(cv0, lTableBits)] = uint16(index0) + sTable[hash4(cv0>>8, sTableBits)] = uint16(index0 + 1) + + lTable[hash7(cv1, lTableBits)] = uint16(index1) + sTable[hash4(cv1>>8, sTableBits)] = uint16(index1 + 1) + index0 += 1 + index1 -= 1 + cv = load64(src, s) + + // Index large values sparsely in between. + // We do two starting from different offsets for speed. + index2 := (index0 + index1 + 1) >> 1 + for index2 < index1 { + lTable[hash7(load64(src, index0), lTableBits)] = uint16(index0) + lTable[hash7(load64(src, index2), lTableBits)] = uint16(index2) + index0 += 2 + index2 += 2 + } + } + +emitRemainder: + if nextEmit < len(src) { + // Bail if we exceed the maximum size. + if d+len(src)-nextEmit > dstLimit { + return 0 + } + d += emitLiteral(dst[d:], src[nextEmit:]) + } + return d +} + // encodeBlockBetterDict encodes a non-empty src to a guaranteed-large-enough dst. It // assumes that the varint-encoded length of the decompressed bytes has already // been written. diff --git a/vendor/github.com/klauspost/compress/s2/encode_go.go b/vendor/github.com/klauspost/compress/s2/encode_go.go index dd1c973ca51..e25b78445d7 100644 --- a/vendor/github.com/klauspost/compress/s2/encode_go.go +++ b/vendor/github.com/klauspost/compress/s2/encode_go.go @@ -21,6 +21,9 @@ func encodeBlock(dst, src []byte) (d int) { if len(src) < minNonLiteralBlockSize { return 0 } + if len(src) <= 64<<10 { + return encodeBlockGo64K(dst, src) + } return encodeBlockGo(dst, src) } @@ -32,6 +35,9 @@ func encodeBlock(dst, src []byte) (d int) { // // len(dst) >= MaxEncodedLen(len(src)) func encodeBlockBetter(dst, src []byte) (d int) { + if len(src) <= 64<<10 { + return encodeBlockBetterGo64K(dst, src) + } return encodeBlockBetterGo(dst, src) } @@ -43,6 +49,9 @@ func encodeBlockBetter(dst, src []byte) (d int) { // // len(dst) >= MaxEncodedLen(len(src)) func encodeBlockBetterSnappy(dst, src []byte) (d int) { + if len(src) <= 64<<10 { + return encodeBlockBetterSnappyGo64K(dst, src) + } return encodeBlockBetterSnappyGo(dst, src) } @@ -57,6 +66,9 @@ func encodeBlockSnappy(dst, src []byte) (d int) { if len(src) < minNonLiteralBlockSize { return 0 } + if len(src) <= 64<<10 { + return encodeBlockSnappyGo64K(dst, src) + } return encodeBlockSnappyGo(dst, src) } diff --git a/vendor/github.com/klauspost/compress/s2sx.mod b/vendor/github.com/klauspost/compress/s2sx.mod index 5a4412f9070..81bda5e2946 100644 --- a/vendor/github.com/klauspost/compress/s2sx.mod +++ b/vendor/github.com/klauspost/compress/s2sx.mod @@ -1,4 +1,3 @@ module github.com/klauspost/compress -go 1.19 - +go 1.22 diff --git a/vendor/github.com/klauspost/compress/zstd/README.md b/vendor/github.com/klauspost/compress/zstd/README.md index 92e2347bbc0..c11d7fa28e3 100644 --- a/vendor/github.com/klauspost/compress/zstd/README.md +++ b/vendor/github.com/klauspost/compress/zstd/README.md @@ -6,7 +6,7 @@ A high performance compression algorithm is implemented. For now focused on spee This package provides [compression](#Compressor) to and [decompression](#Decompressor) of Zstandard content. -This package is pure Go and without use of "unsafe". +This package is pure Go. Use `noasm` and `nounsafe` to disable relevant features. The `zstd` package is provided as open source software using a Go standard license. diff --git a/vendor/github.com/klauspost/compress/zstd/bitreader.go b/vendor/github.com/klauspost/compress/zstd/bitreader.go index 25ca983941d..d41e3e1709b 100644 --- a/vendor/github.com/klauspost/compress/zstd/bitreader.go +++ b/vendor/github.com/klauspost/compress/zstd/bitreader.go @@ -5,11 +5,12 @@ package zstd import ( - "encoding/binary" "errors" "fmt" "io" "math/bits" + + "github.com/klauspost/compress/internal/le" ) // bitReader reads a bitstream in reverse. @@ -18,6 +19,7 @@ import ( type bitReader struct { in []byte value uint64 // Maybe use [16]byte, but shifting is awkward. + cursor int // offset where next read should end bitsRead uint8 } @@ -32,6 +34,7 @@ func (b *bitReader) init(in []byte) error { if v == 0 { return errors.New("corrupt stream, did not find end of stream") } + b.cursor = len(in) b.bitsRead = 64 b.value = 0 if len(in) >= 8 { @@ -67,18 +70,15 @@ func (b *bitReader) fillFast() { if b.bitsRead < 32 { return } - v := b.in[len(b.in)-4:] - b.in = b.in[:len(b.in)-4] - low := (uint32(v[0])) | (uint32(v[1]) << 8) | (uint32(v[2]) << 16) | (uint32(v[3]) << 24) - b.value = (b.value << 32) | uint64(low) + b.cursor -= 4 + b.value = (b.value << 32) | uint64(le.Load32(b.in, b.cursor)) b.bitsRead -= 32 } // fillFastStart() assumes the bitreader is empty and there is at least 8 bytes to read. func (b *bitReader) fillFastStart() { - v := b.in[len(b.in)-8:] - b.in = b.in[:len(b.in)-8] - b.value = binary.LittleEndian.Uint64(v) + b.cursor -= 8 + b.value = le.Load64(b.in, b.cursor) b.bitsRead = 0 } @@ -87,25 +87,23 @@ func (b *bitReader) fill() { if b.bitsRead < 32 { return } - if len(b.in) >= 4 { - v := b.in[len(b.in)-4:] - b.in = b.in[:len(b.in)-4] - low := (uint32(v[0])) | (uint32(v[1]) << 8) | (uint32(v[2]) << 16) | (uint32(v[3]) << 24) - b.value = (b.value << 32) | uint64(low) + if b.cursor >= 4 { + b.cursor -= 4 + b.value = (b.value << 32) | uint64(le.Load32(b.in, b.cursor)) b.bitsRead -= 32 return } - b.bitsRead -= uint8(8 * len(b.in)) - for len(b.in) > 0 { - b.value = (b.value << 8) | uint64(b.in[len(b.in)-1]) - b.in = b.in[:len(b.in)-1] + b.bitsRead -= uint8(8 * b.cursor) + for b.cursor > 0 { + b.cursor -= 1 + b.value = (b.value << 8) | uint64(b.in[b.cursor]) } } // finished returns true if all bits have been read from the bit stream. func (b *bitReader) finished() bool { - return len(b.in) == 0 && b.bitsRead >= 64 + return b.cursor == 0 && b.bitsRead >= 64 } // overread returns true if more bits have been requested than is on the stream. @@ -115,13 +113,14 @@ func (b *bitReader) overread() bool { // remain returns the number of bits remaining. func (b *bitReader) remain() uint { - return 8*uint(len(b.in)) + 64 - uint(b.bitsRead) + return 8*uint(b.cursor) + 64 - uint(b.bitsRead) } // close the bitstream and returns an error if out-of-buffer reads occurred. func (b *bitReader) close() error { // Release reference. b.in = nil + b.cursor = 0 if !b.finished() { return fmt.Errorf("%d extra bits on block, should be 0", b.remain()) } diff --git a/vendor/github.com/klauspost/compress/zstd/blockdec.go b/vendor/github.com/klauspost/compress/zstd/blockdec.go index 9c28840c3bd..0dd742fd2a6 100644 --- a/vendor/github.com/klauspost/compress/zstd/blockdec.go +++ b/vendor/github.com/klauspost/compress/zstd/blockdec.go @@ -5,14 +5,10 @@ package zstd import ( - "bytes" - "encoding/binary" "errors" "fmt" "hash/crc32" "io" - "os" - "path/filepath" "sync" "github.com/klauspost/compress/huff0" @@ -648,21 +644,6 @@ func (b *blockDec) prepareSequences(in []byte, hist *history) (err error) { println("initializing sequences:", err) return err } - // Extract blocks... - if false && hist.dict == nil { - fatalErr := func(err error) { - if err != nil { - panic(err) - } - } - fn := fmt.Sprintf("n-%d-lits-%d-prev-%d-%d-%d-win-%d.blk", hist.decoders.nSeqs, len(hist.decoders.literals), hist.recentOffsets[0], hist.recentOffsets[1], hist.recentOffsets[2], hist.windowSize) - var buf bytes.Buffer - fatalErr(binary.Write(&buf, binary.LittleEndian, hist.decoders.litLengths.fse)) - fatalErr(binary.Write(&buf, binary.LittleEndian, hist.decoders.matchLengths.fse)) - fatalErr(binary.Write(&buf, binary.LittleEndian, hist.decoders.offsets.fse)) - buf.Write(in) - os.WriteFile(filepath.Join("testdata", "seqs", fn), buf.Bytes(), os.ModePerm) - } return nil } diff --git a/vendor/github.com/klauspost/compress/zstd/blockenc.go b/vendor/github.com/klauspost/compress/zstd/blockenc.go index 32a7f401d5d..fd35ea1480a 100644 --- a/vendor/github.com/klauspost/compress/zstd/blockenc.go +++ b/vendor/github.com/klauspost/compress/zstd/blockenc.go @@ -9,6 +9,7 @@ import ( "fmt" "math" "math/bits" + "slices" "github.com/klauspost/compress/huff0" ) @@ -457,16 +458,7 @@ func fuzzFseEncoder(data []byte) int { // All 0 return 0 } - maxCount := func(a []uint32) int { - var max uint32 - for _, v := range a { - if v > max { - max = v - } - } - return int(max) - } - cnt := maxCount(hist[:maxSym]) + cnt := int(slices.Max(hist[:maxSym])) if cnt == len(data) { // RLE return 0 @@ -884,15 +876,6 @@ func (b *blockEnc) genCodes() { } } } - maxCount := func(a []uint32) int { - var max uint32 - for _, v := range a { - if v > max { - max = v - } - } - return int(max) - } if debugAsserts && mlMax > maxMatchLengthSymbol { panic(fmt.Errorf("mlMax > maxMatchLengthSymbol (%d)", mlMax)) } @@ -903,7 +886,7 @@ func (b *blockEnc) genCodes() { panic(fmt.Errorf("llMax > maxLiteralLengthSymbol (%d)", llMax)) } - b.coders.mlEnc.HistogramFinished(mlMax, maxCount(mlH[:mlMax+1])) - b.coders.ofEnc.HistogramFinished(ofMax, maxCount(ofH[:ofMax+1])) - b.coders.llEnc.HistogramFinished(llMax, maxCount(llH[:llMax+1])) + b.coders.mlEnc.HistogramFinished(mlMax, int(slices.Max(mlH[:mlMax+1]))) + b.coders.ofEnc.HistogramFinished(ofMax, int(slices.Max(ofH[:ofMax+1]))) + b.coders.llEnc.HistogramFinished(llMax, int(slices.Max(llH[:llMax+1]))) } diff --git a/vendor/github.com/klauspost/compress/zstd/decoder.go b/vendor/github.com/klauspost/compress/zstd/decoder.go index bbca17234aa..ea2a19376c1 100644 --- a/vendor/github.com/klauspost/compress/zstd/decoder.go +++ b/vendor/github.com/klauspost/compress/zstd/decoder.go @@ -123,7 +123,7 @@ func NewReader(r io.Reader, opts ...DOption) (*Decoder, error) { } // Read bytes from the decompressed stream into p. -// Returns the number of bytes written and any error that occurred. +// Returns the number of bytes read and any error that occurred. // When the stream is done, io.EOF will be returned. func (d *Decoder) Read(p []byte) (int, error) { var n int @@ -323,6 +323,7 @@ func (d *Decoder) DecodeAll(input, dst []byte) ([]byte, error) { frame.bBuf = nil if frame.history.decoders.br != nil { frame.history.decoders.br.in = nil + frame.history.decoders.br.cursor = 0 } d.decoders <- block }() diff --git a/vendor/github.com/klauspost/compress/zstd/enc_base.go b/vendor/github.com/klauspost/compress/zstd/enc_base.go index 5ca46038ad9..7d250c67f59 100644 --- a/vendor/github.com/klauspost/compress/zstd/enc_base.go +++ b/vendor/github.com/klauspost/compress/zstd/enc_base.go @@ -116,7 +116,7 @@ func (e *fastBase) matchlen(s, t int32, src []byte) int32 { panic(err) } if t < 0 { - err := fmt.Sprintf("s (%d) < 0", s) + err := fmt.Sprintf("t (%d) < 0", t) panic(err) } if s-t > e.maxMatchOff { diff --git a/vendor/github.com/klauspost/compress/zstd/matchlen_generic.go b/vendor/github.com/klauspost/compress/zstd/matchlen_generic.go index 57b9c31c027..bea1779e973 100644 --- a/vendor/github.com/klauspost/compress/zstd/matchlen_generic.go +++ b/vendor/github.com/klauspost/compress/zstd/matchlen_generic.go @@ -7,20 +7,25 @@ package zstd import ( - "encoding/binary" "math/bits" + + "github.com/klauspost/compress/internal/le" ) // matchLen returns the maximum common prefix length of a and b. // a must be the shortest of the two. func matchLen(a, b []byte) (n int) { - for ; len(a) >= 8 && len(b) >= 8; a, b = a[8:], b[8:] { - diff := binary.LittleEndian.Uint64(a) ^ binary.LittleEndian.Uint64(b) + left := len(a) + for left >= 8 { + diff := le.Load64(a, n) ^ le.Load64(b, n) if diff != 0 { return n + bits.TrailingZeros64(diff)>>3 } n += 8 + left -= 8 } + a = a[n:] + b = b[n:] for i := range a { if a[i] != b[i] { diff --git a/vendor/github.com/klauspost/compress/zstd/seqdec.go b/vendor/github.com/klauspost/compress/zstd/seqdec.go index d7fe6d82d93..9a7de82f9ef 100644 --- a/vendor/github.com/klauspost/compress/zstd/seqdec.go +++ b/vendor/github.com/klauspost/compress/zstd/seqdec.go @@ -245,7 +245,7 @@ func (s *sequenceDecs) decodeSync(hist []byte) error { return io.ErrUnexpectedEOF } var ll, mo, ml int - if len(br.in) > 4+((maxOffsetBits+16+16)>>3) { + if br.cursor > 4+((maxOffsetBits+16+16)>>3) { // inlined function: // ll, mo, ml = s.nextFast(br, llState, mlState, ofState) diff --git a/vendor/github.com/klauspost/compress/zstd/seqdec_amd64.s b/vendor/github.com/klauspost/compress/zstd/seqdec_amd64.s index f5591fa1e86..a708ca6d3d9 100644 --- a/vendor/github.com/klauspost/compress/zstd/seqdec_amd64.s +++ b/vendor/github.com/klauspost/compress/zstd/seqdec_amd64.s @@ -7,9 +7,9 @@ TEXT ·sequenceDecs_decode_amd64(SB), $8-32 MOVQ br+8(FP), CX MOVQ 24(CX), DX - MOVBQZX 32(CX), BX + MOVBQZX 40(CX), BX MOVQ (CX), AX - MOVQ 8(CX), SI + MOVQ 32(CX), SI ADDQ SI, AX MOVQ AX, (SP) MOVQ ctx+16(FP), AX @@ -299,8 +299,8 @@ sequenceDecs_decode_amd64_match_len_ofs_ok: MOVQ R13, 160(AX) MOVQ br+8(FP), AX MOVQ DX, 24(AX) - MOVB BL, 32(AX) - MOVQ SI, 8(AX) + MOVB BL, 40(AX) + MOVQ SI, 32(AX) // Return success MOVQ $0x00000000, ret+24(FP) @@ -335,9 +335,9 @@ error_overread: TEXT ·sequenceDecs_decode_56_amd64(SB), $8-32 MOVQ br+8(FP), CX MOVQ 24(CX), DX - MOVBQZX 32(CX), BX + MOVBQZX 40(CX), BX MOVQ (CX), AX - MOVQ 8(CX), SI + MOVQ 32(CX), SI ADDQ SI, AX MOVQ AX, (SP) MOVQ ctx+16(FP), AX @@ -598,8 +598,8 @@ sequenceDecs_decode_56_amd64_match_len_ofs_ok: MOVQ R13, 160(AX) MOVQ br+8(FP), AX MOVQ DX, 24(AX) - MOVB BL, 32(AX) - MOVQ SI, 8(AX) + MOVB BL, 40(AX) + MOVQ SI, 32(AX) // Return success MOVQ $0x00000000, ret+24(FP) @@ -634,9 +634,9 @@ error_overread: TEXT ·sequenceDecs_decode_bmi2(SB), $8-32 MOVQ br+8(FP), BX MOVQ 24(BX), AX - MOVBQZX 32(BX), DX + MOVBQZX 40(BX), DX MOVQ (BX), CX - MOVQ 8(BX), BX + MOVQ 32(BX), BX ADDQ BX, CX MOVQ CX, (SP) MOVQ ctx+16(FP), CX @@ -884,8 +884,8 @@ sequenceDecs_decode_bmi2_match_len_ofs_ok: MOVQ R12, 160(CX) MOVQ br+8(FP), CX MOVQ AX, 24(CX) - MOVB DL, 32(CX) - MOVQ BX, 8(CX) + MOVB DL, 40(CX) + MOVQ BX, 32(CX) // Return success MOVQ $0x00000000, ret+24(FP) @@ -920,9 +920,9 @@ error_overread: TEXT ·sequenceDecs_decode_56_bmi2(SB), $8-32 MOVQ br+8(FP), BX MOVQ 24(BX), AX - MOVBQZX 32(BX), DX + MOVBQZX 40(BX), DX MOVQ (BX), CX - MOVQ 8(BX), BX + MOVQ 32(BX), BX ADDQ BX, CX MOVQ CX, (SP) MOVQ ctx+16(FP), CX @@ -1141,8 +1141,8 @@ sequenceDecs_decode_56_bmi2_match_len_ofs_ok: MOVQ R12, 160(CX) MOVQ br+8(FP), CX MOVQ AX, 24(CX) - MOVB DL, 32(CX) - MOVQ BX, 8(CX) + MOVB DL, 40(CX) + MOVQ BX, 32(CX) // Return success MOVQ $0x00000000, ret+24(FP) @@ -1787,9 +1787,9 @@ empty_seqs: TEXT ·sequenceDecs_decodeSync_amd64(SB), $64-32 MOVQ br+8(FP), CX MOVQ 24(CX), DX - MOVBQZX 32(CX), BX + MOVBQZX 40(CX), BX MOVQ (CX), AX - MOVQ 8(CX), SI + MOVQ 32(CX), SI ADDQ SI, AX MOVQ AX, (SP) MOVQ ctx+16(FP), AX @@ -2281,8 +2281,8 @@ handle_loop: loop_finished: MOVQ br+8(FP), AX MOVQ DX, 24(AX) - MOVB BL, 32(AX) - MOVQ SI, 8(AX) + MOVB BL, 40(AX) + MOVQ SI, 32(AX) // Update the context MOVQ ctx+16(FP), AX @@ -2349,9 +2349,9 @@ error_not_enough_space: TEXT ·sequenceDecs_decodeSync_bmi2(SB), $64-32 MOVQ br+8(FP), BX MOVQ 24(BX), AX - MOVBQZX 32(BX), DX + MOVBQZX 40(BX), DX MOVQ (BX), CX - MOVQ 8(BX), BX + MOVQ 32(BX), BX ADDQ BX, CX MOVQ CX, (SP) MOVQ ctx+16(FP), CX @@ -2801,8 +2801,8 @@ handle_loop: loop_finished: MOVQ br+8(FP), CX MOVQ AX, 24(CX) - MOVB DL, 32(CX) - MOVQ BX, 8(CX) + MOVB DL, 40(CX) + MOVQ BX, 32(CX) // Update the context MOVQ ctx+16(FP), AX @@ -2869,9 +2869,9 @@ error_not_enough_space: TEXT ·sequenceDecs_decodeSync_safe_amd64(SB), $64-32 MOVQ br+8(FP), CX MOVQ 24(CX), DX - MOVBQZX 32(CX), BX + MOVBQZX 40(CX), BX MOVQ (CX), AX - MOVQ 8(CX), SI + MOVQ 32(CX), SI ADDQ SI, AX MOVQ AX, (SP) MOVQ ctx+16(FP), AX @@ -3465,8 +3465,8 @@ handle_loop: loop_finished: MOVQ br+8(FP), AX MOVQ DX, 24(AX) - MOVB BL, 32(AX) - MOVQ SI, 8(AX) + MOVB BL, 40(AX) + MOVQ SI, 32(AX) // Update the context MOVQ ctx+16(FP), AX @@ -3533,9 +3533,9 @@ error_not_enough_space: TEXT ·sequenceDecs_decodeSync_safe_bmi2(SB), $64-32 MOVQ br+8(FP), BX MOVQ 24(BX), AX - MOVBQZX 32(BX), DX + MOVBQZX 40(BX), DX MOVQ (BX), CX - MOVQ 8(BX), BX + MOVQ 32(BX), BX ADDQ BX, CX MOVQ CX, (SP) MOVQ ctx+16(FP), CX @@ -4087,8 +4087,8 @@ handle_loop: loop_finished: MOVQ br+8(FP), CX MOVQ AX, 24(CX) - MOVB DL, 32(CX) - MOVQ BX, 8(CX) + MOVB DL, 40(CX) + MOVQ BX, 32(CX) // Update the context MOVQ ctx+16(FP), AX diff --git a/vendor/github.com/klauspost/compress/zstd/seqdec_generic.go b/vendor/github.com/klauspost/compress/zstd/seqdec_generic.go index 2fb35b788c1..7cec2197cd9 100644 --- a/vendor/github.com/klauspost/compress/zstd/seqdec_generic.go +++ b/vendor/github.com/klauspost/compress/zstd/seqdec_generic.go @@ -29,7 +29,7 @@ func (s *sequenceDecs) decode(seqs []seqVals) error { } for i := range seqs { var ll, mo, ml int - if len(br.in) > 4+((maxOffsetBits+16+16)>>3) { + if br.cursor > 4+((maxOffsetBits+16+16)>>3) { // inlined function: // ll, mo, ml = s.nextFast(br, llState, mlState, ofState) diff --git a/vendor/github.com/klauspost/compress/zstd/seqenc.go b/vendor/github.com/klauspost/compress/zstd/seqenc.go index 8014174a771..65045eabdde 100644 --- a/vendor/github.com/klauspost/compress/zstd/seqenc.go +++ b/vendor/github.com/klauspost/compress/zstd/seqenc.go @@ -69,7 +69,6 @@ var llBitsTable = [maxLLCode + 1]byte{ func llCode(litLength uint32) uint8 { const llDeltaCode = 19 if litLength <= 63 { - // Compiler insists on bounds check (Go 1.12) return llCodeTable[litLength&63] } return uint8(highBit(litLength)) + llDeltaCode @@ -102,7 +101,6 @@ var mlBitsTable = [maxMLCode + 1]byte{ func mlCode(mlBase uint32) uint8 { const mlDeltaCode = 36 if mlBase <= 127 { - // Compiler insists on bounds check (Go 1.12) return mlCodeTable[mlBase&127] } return uint8(highBit(mlBase)) + mlDeltaCode diff --git a/vendor/github.com/klauspost/compress/zstd/snappy.go b/vendor/github.com/klauspost/compress/zstd/snappy.go index ec13594e89b..a17381b8f89 100644 --- a/vendor/github.com/klauspost/compress/zstd/snappy.go +++ b/vendor/github.com/klauspost/compress/zstd/snappy.go @@ -197,7 +197,7 @@ func (r *SnappyConverter) Convert(in io.Reader, w io.Writer) (int64, error) { n, r.err = w.Write(r.block.output) if r.err != nil { - return written, err + return written, r.err } written += int64(n) continue @@ -239,7 +239,7 @@ func (r *SnappyConverter) Convert(in io.Reader, w io.Writer) (int64, error) { } n, r.err = w.Write(r.block.output) if r.err != nil { - return written, err + return written, r.err } written += int64(n) continue diff --git a/vendor/github.com/klauspost/compress/zstd/zstd.go b/vendor/github.com/klauspost/compress/zstd/zstd.go index 066bef2a4f0..6252b46ae6f 100644 --- a/vendor/github.com/klauspost/compress/zstd/zstd.go +++ b/vendor/github.com/klauspost/compress/zstd/zstd.go @@ -5,10 +5,11 @@ package zstd import ( "bytes" - "encoding/binary" "errors" "log" "math" + + "github.com/klauspost/compress/internal/le" ) // enable debug printing @@ -110,11 +111,11 @@ func printf(format string, a ...interface{}) { } func load3232(b []byte, i int32) uint32 { - return binary.LittleEndian.Uint32(b[:len(b):len(b)][i:]) + return le.Load32(b, i) } func load6432(b []byte, i int32) uint64 { - return binary.LittleEndian.Uint64(b[:len(b):len(b)][i:]) + return le.Load64(b, i) } type byter interface { diff --git a/vendor/github.com/klauspost/cpuid/v2/.goreleaser.yml b/vendor/github.com/klauspost/cpuid/v2/.goreleaser.yml index 944cc000750..1b695b62c35 100644 --- a/vendor/github.com/klauspost/cpuid/v2/.goreleaser.yml +++ b/vendor/github.com/klauspost/cpuid/v2/.goreleaser.yml @@ -1,5 +1,4 @@ -# This is an example goreleaser.yaml file with some sane defaults. -# Make sure to check the documentation at http://goreleaser.com +version: 2 builds: - @@ -27,16 +26,7 @@ builds: archives: - id: cpuid - name_template: "cpuid-{{ .Os }}_{{ .Arch }}_{{ .Version }}" - replacements: - aix: AIX - darwin: OSX - linux: Linux - windows: Windows - 386: i386 - amd64: x86_64 - freebsd: FreeBSD - netbsd: NetBSD + name_template: "cpuid-{{ .Os }}_{{ .Arch }}{{ if .Arm }}v{{ .Arm }}{{ end }}" format_overrides: - goos: windows format: zip @@ -44,8 +34,6 @@ archives: - LICENSE checksum: name_template: 'checksums.txt' -snapshot: - name_template: "{{ .Tag }}-next" changelog: sort: asc filters: @@ -58,7 +46,7 @@ changelog: nfpms: - - file_name_template: "cpuid_package_{{ .Version }}_{{ .Os }}_{{ .Arch }}" + file_name_template: "cpuid_package_{{ .Os }}_{{ .Arch }}{{ if .Arm }}v{{ .Arm }}{{ end }}" vendor: Klaus Post homepage: https://github.com/klauspost/cpuid maintainer: Klaus Post @@ -67,8 +55,3 @@ nfpms: formats: - deb - rpm - replacements: - darwin: Darwin - linux: Linux - freebsd: FreeBSD - amd64: x86_64 diff --git a/vendor/github.com/klauspost/cpuid/v2/README.md b/vendor/github.com/klauspost/cpuid/v2/README.md index 21508edbdb3..e59d3d0c08e 100644 --- a/vendor/github.com/klauspost/cpuid/v2/README.md +++ b/vendor/github.com/klauspost/cpuid/v2/README.md @@ -281,7 +281,10 @@ Exit Code 1 | AMXBF16 | Tile computational operations on BFLOAT16 numbers | | AMXINT8 | Tile computational operations on 8-bit integers | | AMXFP16 | Tile computational operations on FP16 numbers | +| AMXFP8 | Tile computational operations on FP8 numbers | +| AMXCOMPLEX | Tile computational operations on complex numbers | | AMXTILE | Tile architecture | +| AMXTF32 | Matrix Multiplication of TF32 Tiles into Packed Single Precision Tile | | APX_F | Intel APX | | AVX | AVX functions | | AVX10 | If set the Intel AVX10 Converged Vector ISA is supported | @@ -479,12 +482,16 @@ Exit Code 1 | DCPOP | Data cache clean to Point of Persistence (DC CVAP) | | EVTSTRM | Generic timer | | FCMA | Floatin point complex number addition and multiplication | +| FHM | FMLAL and FMLSL instructions | | FP | Single-precision and double-precision floating point | | FPHP | Half-precision floating point | | GPA | Generic Pointer Authentication | | JSCVT | Javascript-style double->int convert (FJCVTZS) | | LRCPC | Weaker release consistency (LDAPR, etc) | | PMULL | Polynomial Multiply instructions (PMULL/PMULL2) | +| RNDR | Random Number instructions | +| TLB | Outer Shareable and TLB range maintenance instructions | +| TS | Flag manipulation instructions | | SHA1 | SHA-1 instructions (SHA1C, etc) | | SHA2 | SHA-2 instructions (SHA256H, etc) | | SHA3 | SHA-3 instructions (EOR3, RAXI, XAR, BCAX) | diff --git a/vendor/github.com/klauspost/cpuid/v2/cpuid.go b/vendor/github.com/klauspost/cpuid/v2/cpuid.go index 53bc18ca719..8103fb3435c 100644 --- a/vendor/github.com/klauspost/cpuid/v2/cpuid.go +++ b/vendor/github.com/klauspost/cpuid/v2/cpuid.go @@ -55,6 +55,12 @@ const ( Qualcomm Marvell + QEMU + QNX + ACRN + SRE + Apple + lastVendor ) @@ -75,7 +81,10 @@ const ( AMXBF16 // Tile computational operations on BFLOAT16 numbers AMXFP16 // Tile computational operations on FP16 numbers AMXINT8 // Tile computational operations on 8-bit integers + AMXFP8 // Tile computational operations on FP8 numbers AMXTILE // Tile architecture + AMXTF32 // Tile architecture + AMXCOMPLEX // Matrix Multiplication of TF32 Tiles into Packed Single Precision Tile APX_F // Intel APX AVX // AVX functions AVX10 // If set the Intel AVX10 Converged Vector ISA is supported @@ -275,12 +284,16 @@ const ( DCPOP // Data cache clean to Point of Persistence (DC CVAP) EVTSTRM // Generic timer FCMA // Floatin point complex number addition and multiplication + FHM // FMLAL and FMLSL instructions FP // Single-precision and double-precision floating point FPHP // Half-precision floating point GPA // Generic Pointer Authentication JSCVT // Javascript-style double->int convert (FJCVTZS) LRCPC // Weaker release consistency (LDAPR, etc) PMULL // Polynomial Multiply instructions (PMULL/PMULL2) + RNDR // Random Number instructions + TLB // Outer Shareable and TLB range maintenance instructions + TS // Flag manipulation instructions SHA1 // SHA-1 instructions (SHA1C, etc) SHA2 // SHA-2 instructions (SHA256H, etc) SHA3 // SHA-3 instructions (EOR3, RAXI, XAR, BCAX) @@ -296,20 +309,22 @@ const ( // CPUInfo contains information about the detected system CPU. type CPUInfo struct { - BrandName string // Brand name reported by the CPU - VendorID Vendor // Comparable CPU vendor ID - VendorString string // Raw vendor string. - featureSet flagSet // Features of the CPU - PhysicalCores int // Number of physical processor cores in your CPU. Will be 0 if undetectable. - ThreadsPerCore int // Number of threads per physical core. Will be 1 if undetectable. - LogicalCores int // Number of physical cores times threads that can run on each core through the use of hyperthreading. Will be 0 if undetectable. - Family int // CPU family number - Model int // CPU model number - Stepping int // CPU stepping info - CacheLine int // Cache line size in bytes. Will be 0 if undetectable. - Hz int64 // Clock speed, if known, 0 otherwise. Will attempt to contain base clock speed. - BoostFreq int64 // Max clock speed, if known, 0 otherwise - Cache struct { + BrandName string // Brand name reported by the CPU + VendorID Vendor // Comparable CPU vendor ID + VendorString string // Raw vendor string. + HypervisorVendorID Vendor // Hypervisor vendor + HypervisorVendorString string // Raw hypervisor vendor string + featureSet flagSet // Features of the CPU + PhysicalCores int // Number of physical processor cores in your CPU. Will be 0 if undetectable. + ThreadsPerCore int // Number of threads per physical core. Will be 1 if undetectable. + LogicalCores int // Number of physical cores times threads that can run on each core through the use of hyperthreading. Will be 0 if undetectable. + Family int // CPU family number + Model int // CPU model number + Stepping int // CPU stepping info + CacheLine int // Cache line size in bytes. Will be 0 if undetectable. + Hz int64 // Clock speed, if known, 0 otherwise. Will attempt to contain base clock speed. + BoostFreq int64 // Max clock speed, if known, 0 otherwise + Cache struct { L1I int // L1 Instruction Cache (per core or shared). Will be -1 if undetected L1D int // L1 Data Cache (per core or shared). Will be -1 if undetected L2 int // L2 Cache (per core or shared). Will be -1 if undetected @@ -318,8 +333,9 @@ type CPUInfo struct { SGX SGXSupport AMDMemEncryption AMDMemEncryptionSupport AVX10Level uint8 - maxFunc uint32 - maxExFunc uint32 + + maxFunc uint32 + maxExFunc uint32 } var cpuid func(op uint32) (eax, ebx, ecx, edx uint32) @@ -503,7 +519,7 @@ func (c CPUInfo) FeatureSet() []string { // Uses the RDTSCP instruction. The value 0 is returned // if the CPU does not support the instruction. func (c CPUInfo) RTCounter() uint64 { - if !c.Supports(RDTSCP) { + if !c.Has(RDTSCP) { return 0 } a, _, _, d := rdtscpAsm() @@ -515,13 +531,22 @@ func (c CPUInfo) RTCounter() uint64 { // about the current cpu/core the code is running on. // If the RDTSCP instruction isn't supported on the CPU, the value 0 is returned. func (c CPUInfo) Ia32TscAux() uint32 { - if !c.Supports(RDTSCP) { + if !c.Has(RDTSCP) { return 0 } _, _, ecx, _ := rdtscpAsm() return ecx } +// SveLengths returns arm SVE vector and predicate lengths in bits. +// Will return 0, 0 if SVE is not enabled or otherwise unable to detect. +func (c CPUInfo) SveLengths() (vl, pl uint64) { + if !c.Has(SVE) { + return 0, 0 + } + return getVectorLength() +} + // LogicalCPU will return the Logical CPU the code is currently executing on. // This is likely to change when the OS re-schedules the running thread // to another CPU. @@ -781,11 +806,16 @@ func threadsPerCore() int { _, b, _, _ := cpuidex(0xb, 0) if b&0xffff == 0 { if vend == AMD { - // Workaround for AMD returning 0, assume 2 if >= Zen 2 - // It will be more correct than not. + // if >= Zen 2 0x8000001e EBX 15-8 bits means threads per core. + // The number of threads per core is ThreadsPerCore+1 + // See PPR for AMD Family 17h Models 00h-0Fh (page 82) fam, _, _ := familyModel() _, _, _, d := cpuid(1) if (d&(1<<28)) != 0 && fam >= 23 { + if maxExtendedFunction() >= 0x8000001e { + _, b, _, _ := cpuid(0x8000001e) + return int((b>>8)&0xff) + 1 + } return 2 } } @@ -877,7 +907,9 @@ var vendorMapping = map[string]Vendor{ "GenuineTMx86": Transmeta, "Geode by NSC": NSC, "VIA VIA VIA ": VIA, - "KVMKVMKVMKVM": KVM, + "KVMKVMKVM": KVM, + "Linux KVM Hv": KVM, + "TCGTCGTCGTCG": QEMU, "Microsoft Hv": MSVM, "VMwareVMware": VMware, "XenVMMXenVMM": XenHVM, @@ -887,6 +919,10 @@ var vendorMapping = map[string]Vendor{ "SiS SiS SiS ": SiS, "RiseRiseRise": SiS, "Genuine RDC": RDC, + "QNXQVMBSQG": QNX, + "ACRNACRNACRN": ACRN, + "SRESRESRESRE": SRE, + "Apple VZ": Apple, } func vendorID() (Vendor, string) { @@ -899,6 +935,17 @@ func vendorID() (Vendor, string) { return vend, v } +func hypervisorVendorID() (Vendor, string) { + // https://lwn.net/Articles/301888/ + _, b, c, d := cpuid(0x40000000) + v := string(valAsString(b, c, d)) + vend, ok := vendorMapping[v] + if !ok { + return VendorUnknown, v + } + return vend, v +} + func cacheLine() int { if maxFunctionID() < 0x1 { return 0 @@ -1243,6 +1290,8 @@ func support() flagSet { // CPUID.(EAX=7, ECX=1).EDX fs.setIf(edx1&(1<<4) != 0, AVXVNNIINT8) fs.setIf(edx1&(1<<5) != 0, AVXNECONVERT) + fs.setIf(edx1&(1<<7) != 0, AMXTF32) + fs.setIf(edx1&(1<<8) != 0, AMXCOMPLEX) fs.setIf(edx1&(1<<10) != 0, AVXVNNIINT16) fs.setIf(edx1&(1<<14) != 0, PREFETCHI) fs.setIf(edx1&(1<<19) != 0, AVX10) @@ -1271,6 +1320,7 @@ func support() flagSet { fs.setIf(ebx&(1<<31) != 0, AVX512VL) // ecx fs.setIf(ecx&(1<<1) != 0, AVX512VBMI) + fs.setIf(ecx&(1<<3) != 0, AMXFP8) fs.setIf(ecx&(1<<6) != 0, AVX512VBMI2) fs.setIf(ecx&(1<<11) != 0, AVX512VNNI) fs.setIf(ecx&(1<<12) != 0, AVX512BITALG) diff --git a/vendor/github.com/klauspost/cpuid/v2/cpuid_arm64.s b/vendor/github.com/klauspost/cpuid/v2/cpuid_arm64.s index b31d6aec43f..b196f78eb44 100644 --- a/vendor/github.com/klauspost/cpuid/v2/cpuid_arm64.s +++ b/vendor/github.com/klauspost/cpuid/v2/cpuid_arm64.s @@ -24,3 +24,13 @@ TEXT ·getInstAttributes(SB), 7, $0 MOVD R1, instAttrReg1+8(FP) RET +TEXT ·getVectorLength(SB), 7, $0 + WORD $0xd2800002 // mov x2, #0 + WORD $0x04225022 // addvl x2, x2, #1 + WORD $0xd37df042 // lsl x2, x2, #3 + WORD $0xd2800003 // mov x3, #0 + WORD $0x04635023 // addpl x3, x3, #1 + WORD $0xd37df063 // lsl x3, x3, #3 + MOVD R2, vl+0(FP) + MOVD R3, pl+8(FP) + RET diff --git a/vendor/github.com/klauspost/cpuid/v2/detect_arm64.go b/vendor/github.com/klauspost/cpuid/v2/detect_arm64.go index 9a53504a042..9ae32d607dc 100644 --- a/vendor/github.com/klauspost/cpuid/v2/detect_arm64.go +++ b/vendor/github.com/klauspost/cpuid/v2/detect_arm64.go @@ -10,6 +10,7 @@ import "runtime" func getMidr() (midr uint64) func getProcFeatures() (procFeatures uint64) func getInstAttributes() (instAttrReg0, instAttrReg1 uint64) +func getVectorLength() (vl, pl uint64) func initCPU() { cpuid = func(uint32) (a, b, c, d uint32) { return 0, 0, 0, 0 } @@ -24,7 +25,7 @@ func addInfo(c *CPUInfo, safe bool) { detectOS(c) // ARM64 disabled since it may crash if interrupt is not intercepted by OS. - if safe && !c.Supports(ARMCPUID) && runtime.GOOS != "freebsd" { + if safe && !c.Has(ARMCPUID) && runtime.GOOS != "freebsd" { return } midr := getMidr() @@ -156,6 +157,10 @@ func addInfo(c *CPUInfo, safe bool) { // x--------------------------------------------------x // | Name | bits | visible | // |--------------------------------------------------| + // | RNDR | [63-60] | y | + // |--------------------------------------------------| + // | TLB | [59-56] | y | + // |--------------------------------------------------| // | TS | [55-52] | y | // |--------------------------------------------------| // | FHM | [51-48] | y | @@ -181,12 +186,10 @@ func addInfo(c *CPUInfo, safe bool) { // | AES | [7-4] | y | // x--------------------------------------------------x - // if instAttrReg0&(0xf<<52) != 0 { - // fmt.Println("TS") - // } - // if instAttrReg0&(0xf<<48) != 0 { - // fmt.Println("FHM") - // } + f.setIf(instAttrReg0&(0xf<<60) != 0, RNDR) + f.setIf(instAttrReg0&(0xf<<56) != 0, TLB) + f.setIf(instAttrReg0&(0xf<<52) != 0, TS) + f.setIf(instAttrReg0&(0xf<<48) != 0, FHM) f.setIf(instAttrReg0&(0xf<<44) != 0, ASIMDDP) f.setIf(instAttrReg0&(0xf<<40) != 0, SM4) f.setIf(instAttrReg0&(0xf<<36) != 0, SM3) diff --git a/vendor/github.com/klauspost/cpuid/v2/detect_ref.go b/vendor/github.com/klauspost/cpuid/v2/detect_ref.go index 9636c2bc17c..574f9389c07 100644 --- a/vendor/github.com/klauspost/cpuid/v2/detect_ref.go +++ b/vendor/github.com/klauspost/cpuid/v2/detect_ref.go @@ -10,6 +10,8 @@ func initCPU() { cpuidex = func(x, y uint32) (a, b, c, d uint32) { return 0, 0, 0, 0 } xgetbv = func(uint32) (a, b uint32) { return 0, 0 } rdtscpAsm = func() (a, b, c, d uint32) { return 0, 0, 0, 0 } + } func addInfo(info *CPUInfo, safe bool) {} +func getVectorLength() (vl, pl uint64) { return 0, 0 } diff --git a/vendor/github.com/klauspost/cpuid/v2/detect_x86.go b/vendor/github.com/klauspost/cpuid/v2/detect_x86.go index 799b400c2ec..f924c9d8399 100644 --- a/vendor/github.com/klauspost/cpuid/v2/detect_x86.go +++ b/vendor/github.com/klauspost/cpuid/v2/detect_x86.go @@ -32,7 +32,10 @@ func addInfo(c *CPUInfo, safe bool) { c.LogicalCores = logicalCores() c.PhysicalCores = physicalCores() c.VendorID, c.VendorString = vendorID() + c.HypervisorVendorID, c.HypervisorVendorString = hypervisorVendorID() c.AVX10Level = c.supportAVX10() c.cacheSize() c.frequencies() } + +func getVectorLength() (vl, pl uint64) { return 0, 0 } diff --git a/vendor/github.com/klauspost/cpuid/v2/featureid_string.go b/vendor/github.com/klauspost/cpuid/v2/featureid_string.go index 3a256031039..04760c1af32 100644 --- a/vendor/github.com/klauspost/cpuid/v2/featureid_string.go +++ b/vendor/github.com/klauspost/cpuid/v2/featureid_string.go @@ -15,224 +15,231 @@ func _() { _ = x[AMXBF16-5] _ = x[AMXFP16-6] _ = x[AMXINT8-7] - _ = x[AMXTILE-8] - _ = x[APX_F-9] - _ = x[AVX-10] - _ = x[AVX10-11] - _ = x[AVX10_128-12] - _ = x[AVX10_256-13] - _ = x[AVX10_512-14] - _ = x[AVX2-15] - _ = x[AVX512BF16-16] - _ = x[AVX512BITALG-17] - _ = x[AVX512BW-18] - _ = x[AVX512CD-19] - _ = x[AVX512DQ-20] - _ = x[AVX512ER-21] - _ = x[AVX512F-22] - _ = x[AVX512FP16-23] - _ = x[AVX512IFMA-24] - _ = x[AVX512PF-25] - _ = x[AVX512VBMI-26] - _ = x[AVX512VBMI2-27] - _ = x[AVX512VL-28] - _ = x[AVX512VNNI-29] - _ = x[AVX512VP2INTERSECT-30] - _ = x[AVX512VPOPCNTDQ-31] - _ = x[AVXIFMA-32] - _ = x[AVXNECONVERT-33] - _ = x[AVXSLOW-34] - _ = x[AVXVNNI-35] - _ = x[AVXVNNIINT8-36] - _ = x[AVXVNNIINT16-37] - _ = x[BHI_CTRL-38] - _ = x[BMI1-39] - _ = x[BMI2-40] - _ = x[CETIBT-41] - _ = x[CETSS-42] - _ = x[CLDEMOTE-43] - _ = x[CLMUL-44] - _ = x[CLZERO-45] - _ = x[CMOV-46] - _ = x[CMPCCXADD-47] - _ = x[CMPSB_SCADBS_SHORT-48] - _ = x[CMPXCHG8-49] - _ = x[CPBOOST-50] - _ = x[CPPC-51] - _ = x[CX16-52] - _ = x[EFER_LMSLE_UNS-53] - _ = x[ENQCMD-54] - _ = x[ERMS-55] - _ = x[F16C-56] - _ = x[FLUSH_L1D-57] - _ = x[FMA3-58] - _ = x[FMA4-59] - _ = x[FP128-60] - _ = x[FP256-61] - _ = x[FSRM-62] - _ = x[FXSR-63] - _ = x[FXSROPT-64] - _ = x[GFNI-65] - _ = x[HLE-66] - _ = x[HRESET-67] - _ = x[HTT-68] - _ = x[HWA-69] - _ = x[HYBRID_CPU-70] - _ = x[HYPERVISOR-71] - _ = x[IA32_ARCH_CAP-72] - _ = x[IA32_CORE_CAP-73] - _ = x[IBPB-74] - _ = x[IBPB_BRTYPE-75] - _ = x[IBRS-76] - _ = x[IBRS_PREFERRED-77] - _ = x[IBRS_PROVIDES_SMP-78] - _ = x[IBS-79] - _ = x[IBSBRNTRGT-80] - _ = x[IBSFETCHSAM-81] - _ = x[IBSFFV-82] - _ = x[IBSOPCNT-83] - _ = x[IBSOPCNTEXT-84] - _ = x[IBSOPSAM-85] - _ = x[IBSRDWROPCNT-86] - _ = x[IBSRIPINVALIDCHK-87] - _ = x[IBS_FETCH_CTLX-88] - _ = x[IBS_OPDATA4-89] - _ = x[IBS_OPFUSE-90] - _ = x[IBS_PREVENTHOST-91] - _ = x[IBS_ZEN4-92] - _ = x[IDPRED_CTRL-93] - _ = x[INT_WBINVD-94] - _ = x[INVLPGB-95] - _ = x[KEYLOCKER-96] - _ = x[KEYLOCKERW-97] - _ = x[LAHF-98] - _ = x[LAM-99] - _ = x[LBRVIRT-100] - _ = x[LZCNT-101] - _ = x[MCAOVERFLOW-102] - _ = x[MCDT_NO-103] - _ = x[MCOMMIT-104] - _ = x[MD_CLEAR-105] - _ = x[MMX-106] - _ = x[MMXEXT-107] - _ = x[MOVBE-108] - _ = x[MOVDIR64B-109] - _ = x[MOVDIRI-110] - _ = x[MOVSB_ZL-111] - _ = x[MOVU-112] - _ = x[MPX-113] - _ = x[MSRIRC-114] - _ = x[MSRLIST-115] - _ = x[MSR_PAGEFLUSH-116] - _ = x[NRIPS-117] - _ = x[NX-118] - _ = x[OSXSAVE-119] - _ = x[PCONFIG-120] - _ = x[POPCNT-121] - _ = x[PPIN-122] - _ = x[PREFETCHI-123] - _ = x[PSFD-124] - _ = x[RDPRU-125] - _ = x[RDRAND-126] - _ = x[RDSEED-127] - _ = x[RDTSCP-128] - _ = x[RRSBA_CTRL-129] - _ = x[RTM-130] - _ = x[RTM_ALWAYS_ABORT-131] - _ = x[SBPB-132] - _ = x[SERIALIZE-133] - _ = x[SEV-134] - _ = x[SEV_64BIT-135] - _ = x[SEV_ALTERNATIVE-136] - _ = x[SEV_DEBUGSWAP-137] - _ = x[SEV_ES-138] - _ = x[SEV_RESTRICTED-139] - _ = x[SEV_SNP-140] - _ = x[SGX-141] - _ = x[SGXLC-142] - _ = x[SHA-143] - _ = x[SME-144] - _ = x[SME_COHERENT-145] - _ = x[SPEC_CTRL_SSBD-146] - _ = x[SRBDS_CTRL-147] - _ = x[SRSO_MSR_FIX-148] - _ = x[SRSO_NO-149] - _ = x[SRSO_USER_KERNEL_NO-150] - _ = x[SSE-151] - _ = x[SSE2-152] - _ = x[SSE3-153] - _ = x[SSE4-154] - _ = x[SSE42-155] - _ = x[SSE4A-156] - _ = x[SSSE3-157] - _ = x[STIBP-158] - _ = x[STIBP_ALWAYSON-159] - _ = x[STOSB_SHORT-160] - _ = x[SUCCOR-161] - _ = x[SVM-162] - _ = x[SVMDA-163] - _ = x[SVMFBASID-164] - _ = x[SVML-165] - _ = x[SVMNP-166] - _ = x[SVMPF-167] - _ = x[SVMPFT-168] - _ = x[SYSCALL-169] - _ = x[SYSEE-170] - _ = x[TBM-171] - _ = x[TDX_GUEST-172] - _ = x[TLB_FLUSH_NESTED-173] - _ = x[TME-174] - _ = x[TOPEXT-175] - _ = x[TSCRATEMSR-176] - _ = x[TSXLDTRK-177] - _ = x[VAES-178] - _ = x[VMCBCLEAN-179] - _ = x[VMPL-180] - _ = x[VMSA_REGPROT-181] - _ = x[VMX-182] - _ = x[VPCLMULQDQ-183] - _ = x[VTE-184] - _ = x[WAITPKG-185] - _ = x[WBNOINVD-186] - _ = x[WRMSRNS-187] - _ = x[X87-188] - _ = x[XGETBV1-189] - _ = x[XOP-190] - _ = x[XSAVE-191] - _ = x[XSAVEC-192] - _ = x[XSAVEOPT-193] - _ = x[XSAVES-194] - _ = x[AESARM-195] - _ = x[ARMCPUID-196] - _ = x[ASIMD-197] - _ = x[ASIMDDP-198] - _ = x[ASIMDHP-199] - _ = x[ASIMDRDM-200] - _ = x[ATOMICS-201] - _ = x[CRC32-202] - _ = x[DCPOP-203] - _ = x[EVTSTRM-204] - _ = x[FCMA-205] - _ = x[FP-206] - _ = x[FPHP-207] - _ = x[GPA-208] - _ = x[JSCVT-209] - _ = x[LRCPC-210] - _ = x[PMULL-211] - _ = x[SHA1-212] - _ = x[SHA2-213] - _ = x[SHA3-214] - _ = x[SHA512-215] - _ = x[SM3-216] - _ = x[SM4-217] - _ = x[SVE-218] - _ = x[lastID-219] + _ = x[AMXFP8-8] + _ = x[AMXTILE-9] + _ = x[AMXTF32-10] + _ = x[AMXCOMPLEX-11] + _ = x[APX_F-12] + _ = x[AVX-13] + _ = x[AVX10-14] + _ = x[AVX10_128-15] + _ = x[AVX10_256-16] + _ = x[AVX10_512-17] + _ = x[AVX2-18] + _ = x[AVX512BF16-19] + _ = x[AVX512BITALG-20] + _ = x[AVX512BW-21] + _ = x[AVX512CD-22] + _ = x[AVX512DQ-23] + _ = x[AVX512ER-24] + _ = x[AVX512F-25] + _ = x[AVX512FP16-26] + _ = x[AVX512IFMA-27] + _ = x[AVX512PF-28] + _ = x[AVX512VBMI-29] + _ = x[AVX512VBMI2-30] + _ = x[AVX512VL-31] + _ = x[AVX512VNNI-32] + _ = x[AVX512VP2INTERSECT-33] + _ = x[AVX512VPOPCNTDQ-34] + _ = x[AVXIFMA-35] + _ = x[AVXNECONVERT-36] + _ = x[AVXSLOW-37] + _ = x[AVXVNNI-38] + _ = x[AVXVNNIINT8-39] + _ = x[AVXVNNIINT16-40] + _ = x[BHI_CTRL-41] + _ = x[BMI1-42] + _ = x[BMI2-43] + _ = x[CETIBT-44] + _ = x[CETSS-45] + _ = x[CLDEMOTE-46] + _ = x[CLMUL-47] + _ = x[CLZERO-48] + _ = x[CMOV-49] + _ = x[CMPCCXADD-50] + _ = x[CMPSB_SCADBS_SHORT-51] + _ = x[CMPXCHG8-52] + _ = x[CPBOOST-53] + _ = x[CPPC-54] + _ = x[CX16-55] + _ = x[EFER_LMSLE_UNS-56] + _ = x[ENQCMD-57] + _ = x[ERMS-58] + _ = x[F16C-59] + _ = x[FLUSH_L1D-60] + _ = x[FMA3-61] + _ = x[FMA4-62] + _ = x[FP128-63] + _ = x[FP256-64] + _ = x[FSRM-65] + _ = x[FXSR-66] + _ = x[FXSROPT-67] + _ = x[GFNI-68] + _ = x[HLE-69] + _ = x[HRESET-70] + _ = x[HTT-71] + _ = x[HWA-72] + _ = x[HYBRID_CPU-73] + _ = x[HYPERVISOR-74] + _ = x[IA32_ARCH_CAP-75] + _ = x[IA32_CORE_CAP-76] + _ = x[IBPB-77] + _ = x[IBPB_BRTYPE-78] + _ = x[IBRS-79] + _ = x[IBRS_PREFERRED-80] + _ = x[IBRS_PROVIDES_SMP-81] + _ = x[IBS-82] + _ = x[IBSBRNTRGT-83] + _ = x[IBSFETCHSAM-84] + _ = x[IBSFFV-85] + _ = x[IBSOPCNT-86] + _ = x[IBSOPCNTEXT-87] + _ = x[IBSOPSAM-88] + _ = x[IBSRDWROPCNT-89] + _ = x[IBSRIPINVALIDCHK-90] + _ = x[IBS_FETCH_CTLX-91] + _ = x[IBS_OPDATA4-92] + _ = x[IBS_OPFUSE-93] + _ = x[IBS_PREVENTHOST-94] + _ = x[IBS_ZEN4-95] + _ = x[IDPRED_CTRL-96] + _ = x[INT_WBINVD-97] + _ = x[INVLPGB-98] + _ = x[KEYLOCKER-99] + _ = x[KEYLOCKERW-100] + _ = x[LAHF-101] + _ = x[LAM-102] + _ = x[LBRVIRT-103] + _ = x[LZCNT-104] + _ = x[MCAOVERFLOW-105] + _ = x[MCDT_NO-106] + _ = x[MCOMMIT-107] + _ = x[MD_CLEAR-108] + _ = x[MMX-109] + _ = x[MMXEXT-110] + _ = x[MOVBE-111] + _ = x[MOVDIR64B-112] + _ = x[MOVDIRI-113] + _ = x[MOVSB_ZL-114] + _ = x[MOVU-115] + _ = x[MPX-116] + _ = x[MSRIRC-117] + _ = x[MSRLIST-118] + _ = x[MSR_PAGEFLUSH-119] + _ = x[NRIPS-120] + _ = x[NX-121] + _ = x[OSXSAVE-122] + _ = x[PCONFIG-123] + _ = x[POPCNT-124] + _ = x[PPIN-125] + _ = x[PREFETCHI-126] + _ = x[PSFD-127] + _ = x[RDPRU-128] + _ = x[RDRAND-129] + _ = x[RDSEED-130] + _ = x[RDTSCP-131] + _ = x[RRSBA_CTRL-132] + _ = x[RTM-133] + _ = x[RTM_ALWAYS_ABORT-134] + _ = x[SBPB-135] + _ = x[SERIALIZE-136] + _ = x[SEV-137] + _ = x[SEV_64BIT-138] + _ = x[SEV_ALTERNATIVE-139] + _ = x[SEV_DEBUGSWAP-140] + _ = x[SEV_ES-141] + _ = x[SEV_RESTRICTED-142] + _ = x[SEV_SNP-143] + _ = x[SGX-144] + _ = x[SGXLC-145] + _ = x[SHA-146] + _ = x[SME-147] + _ = x[SME_COHERENT-148] + _ = x[SPEC_CTRL_SSBD-149] + _ = x[SRBDS_CTRL-150] + _ = x[SRSO_MSR_FIX-151] + _ = x[SRSO_NO-152] + _ = x[SRSO_USER_KERNEL_NO-153] + _ = x[SSE-154] + _ = x[SSE2-155] + _ = x[SSE3-156] + _ = x[SSE4-157] + _ = x[SSE42-158] + _ = x[SSE4A-159] + _ = x[SSSE3-160] + _ = x[STIBP-161] + _ = x[STIBP_ALWAYSON-162] + _ = x[STOSB_SHORT-163] + _ = x[SUCCOR-164] + _ = x[SVM-165] + _ = x[SVMDA-166] + _ = x[SVMFBASID-167] + _ = x[SVML-168] + _ = x[SVMNP-169] + _ = x[SVMPF-170] + _ = x[SVMPFT-171] + _ = x[SYSCALL-172] + _ = x[SYSEE-173] + _ = x[TBM-174] + _ = x[TDX_GUEST-175] + _ = x[TLB_FLUSH_NESTED-176] + _ = x[TME-177] + _ = x[TOPEXT-178] + _ = x[TSCRATEMSR-179] + _ = x[TSXLDTRK-180] + _ = x[VAES-181] + _ = x[VMCBCLEAN-182] + _ = x[VMPL-183] + _ = x[VMSA_REGPROT-184] + _ = x[VMX-185] + _ = x[VPCLMULQDQ-186] + _ = x[VTE-187] + _ = x[WAITPKG-188] + _ = x[WBNOINVD-189] + _ = x[WRMSRNS-190] + _ = x[X87-191] + _ = x[XGETBV1-192] + _ = x[XOP-193] + _ = x[XSAVE-194] + _ = x[XSAVEC-195] + _ = x[XSAVEOPT-196] + _ = x[XSAVES-197] + _ = x[AESARM-198] + _ = x[ARMCPUID-199] + _ = x[ASIMD-200] + _ = x[ASIMDDP-201] + _ = x[ASIMDHP-202] + _ = x[ASIMDRDM-203] + _ = x[ATOMICS-204] + _ = x[CRC32-205] + _ = x[DCPOP-206] + _ = x[EVTSTRM-207] + _ = x[FCMA-208] + _ = x[FHM-209] + _ = x[FP-210] + _ = x[FPHP-211] + _ = x[GPA-212] + _ = x[JSCVT-213] + _ = x[LRCPC-214] + _ = x[PMULL-215] + _ = x[RNDR-216] + _ = x[TLB-217] + _ = x[TS-218] + _ = x[SHA1-219] + _ = x[SHA2-220] + _ = x[SHA3-221] + _ = x[SHA512-222] + _ = x[SM3-223] + _ = x[SM4-224] + _ = x[SVE-225] + _ = x[lastID-226] _ = x[firstID-0] } -const _FeatureID_name = "firstIDADXAESNIAMD3DNOWAMD3DNOWEXTAMXBF16AMXFP16AMXINT8AMXTILEAPX_FAVXAVX10AVX10_128AVX10_256AVX10_512AVX2AVX512BF16AVX512BITALGAVX512BWAVX512CDAVX512DQAVX512ERAVX512FAVX512FP16AVX512IFMAAVX512PFAVX512VBMIAVX512VBMI2AVX512VLAVX512VNNIAVX512VP2INTERSECTAVX512VPOPCNTDQAVXIFMAAVXNECONVERTAVXSLOWAVXVNNIAVXVNNIINT8AVXVNNIINT16BHI_CTRLBMI1BMI2CETIBTCETSSCLDEMOTECLMULCLZEROCMOVCMPCCXADDCMPSB_SCADBS_SHORTCMPXCHG8CPBOOSTCPPCCX16EFER_LMSLE_UNSENQCMDERMSF16CFLUSH_L1DFMA3FMA4FP128FP256FSRMFXSRFXSROPTGFNIHLEHRESETHTTHWAHYBRID_CPUHYPERVISORIA32_ARCH_CAPIA32_CORE_CAPIBPBIBPB_BRTYPEIBRSIBRS_PREFERREDIBRS_PROVIDES_SMPIBSIBSBRNTRGTIBSFETCHSAMIBSFFVIBSOPCNTIBSOPCNTEXTIBSOPSAMIBSRDWROPCNTIBSRIPINVALIDCHKIBS_FETCH_CTLXIBS_OPDATA4IBS_OPFUSEIBS_PREVENTHOSTIBS_ZEN4IDPRED_CTRLINT_WBINVDINVLPGBKEYLOCKERKEYLOCKERWLAHFLAMLBRVIRTLZCNTMCAOVERFLOWMCDT_NOMCOMMITMD_CLEARMMXMMXEXTMOVBEMOVDIR64BMOVDIRIMOVSB_ZLMOVUMPXMSRIRCMSRLISTMSR_PAGEFLUSHNRIPSNXOSXSAVEPCONFIGPOPCNTPPINPREFETCHIPSFDRDPRURDRANDRDSEEDRDTSCPRRSBA_CTRLRTMRTM_ALWAYS_ABORTSBPBSERIALIZESEVSEV_64BITSEV_ALTERNATIVESEV_DEBUGSWAPSEV_ESSEV_RESTRICTEDSEV_SNPSGXSGXLCSHASMESME_COHERENTSPEC_CTRL_SSBDSRBDS_CTRLSRSO_MSR_FIXSRSO_NOSRSO_USER_KERNEL_NOSSESSE2SSE3SSE4SSE42SSE4ASSSE3STIBPSTIBP_ALWAYSONSTOSB_SHORTSUCCORSVMSVMDASVMFBASIDSVMLSVMNPSVMPFSVMPFTSYSCALLSYSEETBMTDX_GUESTTLB_FLUSH_NESTEDTMETOPEXTTSCRATEMSRTSXLDTRKVAESVMCBCLEANVMPLVMSA_REGPROTVMXVPCLMULQDQVTEWAITPKGWBNOINVDWRMSRNSX87XGETBV1XOPXSAVEXSAVECXSAVEOPTXSAVESAESARMARMCPUIDASIMDASIMDDPASIMDHPASIMDRDMATOMICSCRC32DCPOPEVTSTRMFCMAFPFPHPGPAJSCVTLRCPCPMULLSHA1SHA2SHA3SHA512SM3SM4SVElastID" +const _FeatureID_name = "firstIDADXAESNIAMD3DNOWAMD3DNOWEXTAMXBF16AMXFP16AMXINT8AMXFP8AMXTILEAMXTF32AMXCOMPLEXAPX_FAVXAVX10AVX10_128AVX10_256AVX10_512AVX2AVX512BF16AVX512BITALGAVX512BWAVX512CDAVX512DQAVX512ERAVX512FAVX512FP16AVX512IFMAAVX512PFAVX512VBMIAVX512VBMI2AVX512VLAVX512VNNIAVX512VP2INTERSECTAVX512VPOPCNTDQAVXIFMAAVXNECONVERTAVXSLOWAVXVNNIAVXVNNIINT8AVXVNNIINT16BHI_CTRLBMI1BMI2CETIBTCETSSCLDEMOTECLMULCLZEROCMOVCMPCCXADDCMPSB_SCADBS_SHORTCMPXCHG8CPBOOSTCPPCCX16EFER_LMSLE_UNSENQCMDERMSF16CFLUSH_L1DFMA3FMA4FP128FP256FSRMFXSRFXSROPTGFNIHLEHRESETHTTHWAHYBRID_CPUHYPERVISORIA32_ARCH_CAPIA32_CORE_CAPIBPBIBPB_BRTYPEIBRSIBRS_PREFERREDIBRS_PROVIDES_SMPIBSIBSBRNTRGTIBSFETCHSAMIBSFFVIBSOPCNTIBSOPCNTEXTIBSOPSAMIBSRDWROPCNTIBSRIPINVALIDCHKIBS_FETCH_CTLXIBS_OPDATA4IBS_OPFUSEIBS_PREVENTHOSTIBS_ZEN4IDPRED_CTRLINT_WBINVDINVLPGBKEYLOCKERKEYLOCKERWLAHFLAMLBRVIRTLZCNTMCAOVERFLOWMCDT_NOMCOMMITMD_CLEARMMXMMXEXTMOVBEMOVDIR64BMOVDIRIMOVSB_ZLMOVUMPXMSRIRCMSRLISTMSR_PAGEFLUSHNRIPSNXOSXSAVEPCONFIGPOPCNTPPINPREFETCHIPSFDRDPRURDRANDRDSEEDRDTSCPRRSBA_CTRLRTMRTM_ALWAYS_ABORTSBPBSERIALIZESEVSEV_64BITSEV_ALTERNATIVESEV_DEBUGSWAPSEV_ESSEV_RESTRICTEDSEV_SNPSGXSGXLCSHASMESME_COHERENTSPEC_CTRL_SSBDSRBDS_CTRLSRSO_MSR_FIXSRSO_NOSRSO_USER_KERNEL_NOSSESSE2SSE3SSE4SSE42SSE4ASSSE3STIBPSTIBP_ALWAYSONSTOSB_SHORTSUCCORSVMSVMDASVMFBASIDSVMLSVMNPSVMPFSVMPFTSYSCALLSYSEETBMTDX_GUESTTLB_FLUSH_NESTEDTMETOPEXTTSCRATEMSRTSXLDTRKVAESVMCBCLEANVMPLVMSA_REGPROTVMXVPCLMULQDQVTEWAITPKGWBNOINVDWRMSRNSX87XGETBV1XOPXSAVEXSAVECXSAVEOPTXSAVESAESARMARMCPUIDASIMDASIMDDPASIMDHPASIMDRDMATOMICSCRC32DCPOPEVTSTRMFCMAFHMFPFPHPGPAJSCVTLRCPCPMULLRNDRTLBTSSHA1SHA2SHA3SHA512SM3SM4SVElastID" -var _FeatureID_index = [...]uint16{0, 7, 10, 15, 23, 34, 41, 48, 55, 62, 67, 70, 75, 84, 93, 102, 106, 116, 128, 136, 144, 152, 160, 167, 177, 187, 195, 205, 216, 224, 234, 252, 267, 274, 286, 293, 300, 311, 323, 331, 335, 339, 345, 350, 358, 363, 369, 373, 382, 400, 408, 415, 419, 423, 437, 443, 447, 451, 460, 464, 468, 473, 478, 482, 486, 493, 497, 500, 506, 509, 512, 522, 532, 545, 558, 562, 573, 577, 591, 608, 611, 621, 632, 638, 646, 657, 665, 677, 693, 707, 718, 728, 743, 751, 762, 772, 779, 788, 798, 802, 805, 812, 817, 828, 835, 842, 850, 853, 859, 864, 873, 880, 888, 892, 895, 901, 908, 921, 926, 928, 935, 942, 948, 952, 961, 965, 970, 976, 982, 988, 998, 1001, 1017, 1021, 1030, 1033, 1042, 1057, 1070, 1076, 1090, 1097, 1100, 1105, 1108, 1111, 1123, 1137, 1147, 1159, 1166, 1185, 1188, 1192, 1196, 1200, 1205, 1210, 1215, 1220, 1234, 1245, 1251, 1254, 1259, 1268, 1272, 1277, 1282, 1288, 1295, 1300, 1303, 1312, 1328, 1331, 1337, 1347, 1355, 1359, 1368, 1372, 1384, 1387, 1397, 1400, 1407, 1415, 1422, 1425, 1432, 1435, 1440, 1446, 1454, 1460, 1466, 1474, 1479, 1486, 1493, 1501, 1508, 1513, 1518, 1525, 1529, 1531, 1535, 1538, 1543, 1548, 1553, 1557, 1561, 1565, 1571, 1574, 1577, 1580, 1586} +var _FeatureID_index = [...]uint16{0, 7, 10, 15, 23, 34, 41, 48, 55, 61, 68, 75, 85, 90, 93, 98, 107, 116, 125, 129, 139, 151, 159, 167, 175, 183, 190, 200, 210, 218, 228, 239, 247, 257, 275, 290, 297, 309, 316, 323, 334, 346, 354, 358, 362, 368, 373, 381, 386, 392, 396, 405, 423, 431, 438, 442, 446, 460, 466, 470, 474, 483, 487, 491, 496, 501, 505, 509, 516, 520, 523, 529, 532, 535, 545, 555, 568, 581, 585, 596, 600, 614, 631, 634, 644, 655, 661, 669, 680, 688, 700, 716, 730, 741, 751, 766, 774, 785, 795, 802, 811, 821, 825, 828, 835, 840, 851, 858, 865, 873, 876, 882, 887, 896, 903, 911, 915, 918, 924, 931, 944, 949, 951, 958, 965, 971, 975, 984, 988, 993, 999, 1005, 1011, 1021, 1024, 1040, 1044, 1053, 1056, 1065, 1080, 1093, 1099, 1113, 1120, 1123, 1128, 1131, 1134, 1146, 1160, 1170, 1182, 1189, 1208, 1211, 1215, 1219, 1223, 1228, 1233, 1238, 1243, 1257, 1268, 1274, 1277, 1282, 1291, 1295, 1300, 1305, 1311, 1318, 1323, 1326, 1335, 1351, 1354, 1360, 1370, 1378, 1382, 1391, 1395, 1407, 1410, 1420, 1423, 1430, 1438, 1445, 1448, 1455, 1458, 1463, 1469, 1477, 1483, 1489, 1497, 1502, 1509, 1516, 1524, 1531, 1536, 1541, 1548, 1552, 1555, 1557, 1561, 1564, 1569, 1574, 1579, 1583, 1586, 1588, 1592, 1596, 1600, 1606, 1609, 1612, 1615, 1621} func (i FeatureID) String() string { if i < 0 || i >= FeatureID(len(_FeatureID_index)-1) { @@ -270,12 +277,17 @@ func _() { _ = x[AMCC-23] _ = x[Qualcomm-24] _ = x[Marvell-25] - _ = x[lastVendor-26] + _ = x[QEMU-26] + _ = x[QNX-27] + _ = x[ACRN-28] + _ = x[SRE-29] + _ = x[Apple-30] + _ = x[lastVendor-31] } -const _Vendor_name = "VendorUnknownIntelAMDVIATransmetaNSCKVMMSVMVMwareXenHVMBhyveHygonSiSRDCAmpereARMBroadcomCaviumDECFujitsuInfineonMotorolaNVIDIAAMCCQualcommMarvelllastVendor" +const _Vendor_name = "VendorUnknownIntelAMDVIATransmetaNSCKVMMSVMVMwareXenHVMBhyveHygonSiSRDCAmpereARMBroadcomCaviumDECFujitsuInfineonMotorolaNVIDIAAMCCQualcommMarvellQEMUQNXACRNSREApplelastVendor" -var _Vendor_index = [...]uint8{0, 13, 18, 21, 24, 33, 36, 39, 43, 49, 55, 60, 65, 68, 71, 77, 80, 88, 94, 97, 104, 112, 120, 126, 130, 138, 145, 155} +var _Vendor_index = [...]uint8{0, 13, 18, 21, 24, 33, 36, 39, 43, 49, 55, 60, 65, 68, 71, 77, 80, 88, 94, 97, 104, 112, 120, 126, 130, 138, 145, 149, 152, 156, 159, 164, 174} func (i Vendor) String() string { if i < 0 || i >= Vendor(len(_Vendor_index)-1) { diff --git a/vendor/github.com/klauspost/cpuid/v2/os_darwin_arm64.go b/vendor/github.com/klauspost/cpuid/v2/os_darwin_arm64.go index 84b1acd2153..6f0b33ca6ec 100644 --- a/vendor/github.com/klauspost/cpuid/v2/os_darwin_arm64.go +++ b/vendor/github.com/klauspost/cpuid/v2/os_darwin_arm64.go @@ -96,9 +96,11 @@ func tryToFillCPUInfoFomSysctl(c *CPUInfo) { setFeature(c, "hw.optional.arm.FEAT_DPB", DCPOP) // setFeature(c, "", EVTSTRM) setFeature(c, "hw.optional.arm.FEAT_FCMA", FCMA) + setFeature(c, "hw.optional.arm.FEAT_FHM", FHM) setFeature(c, "hw.optional.arm.FEAT_FP", FP) setFeature(c, "hw.optional.arm.FEAT_FP16", FPHP) setFeature(c, "hw.optional.arm.FEAT_PAuth", GPA) + setFeature(c, "hw.optional.arm.FEAT_RNG", RNDR) setFeature(c, "hw.optional.arm.FEAT_JSCVT", JSCVT) setFeature(c, "hw.optional.arm.FEAT_LRCPC", LRCPC) setFeature(c, "hw.optional.arm.FEAT_PMULL", PMULL) @@ -106,6 +108,10 @@ func tryToFillCPUInfoFomSysctl(c *CPUInfo) { setFeature(c, "hw.optional.arm.FEAT_SHA256", SHA2) setFeature(c, "hw.optional.arm.FEAT_SHA3", SHA3) setFeature(c, "hw.optional.arm.FEAT_SHA512", SHA512) + setFeature(c, "hw.optional.arm.FEAT_TLBIOS", TLB) + setFeature(c, "hw.optional.arm.FEAT_TLBIRANGE", TLB) + setFeature(c, "hw.optional.arm.FEAT_FlagM", TS) + setFeature(c, "hw.optional.arm.FEAT_FlagM2", TS) // setFeature(c, "", SM3) // setFeature(c, "", SM4) setFeature(c, "hw.optional.arm.FEAT_SVE", SVE) diff --git a/vendor/github.com/klauspost/cpuid/v2/os_linux_arm64.go b/vendor/github.com/klauspost/cpuid/v2/os_linux_arm64.go index ee278b9e4bc..d96d24438b3 100644 --- a/vendor/github.com/klauspost/cpuid/v2/os_linux_arm64.go +++ b/vendor/github.com/klauspost/cpuid/v2/os_linux_arm64.go @@ -39,6 +39,80 @@ const ( hwcap_SHA512 = 1 << 21 hwcap_SVE = 1 << 22 hwcap_ASIMDFHM = 1 << 23 + hwcap_DIT = 1 << 24 + hwcap_USCAT = 1 << 25 + hwcap_ILRCPC = 1 << 26 + hwcap_FLAGM = 1 << 27 + hwcap_SSBS = 1 << 28 + hwcap_SB = 1 << 29 + hwcap_PACA = 1 << 30 + hwcap_PACG = 1 << 31 + hwcap_GCS = 1 << 32 + + hwcap2_DCPODP = 1 << 0 + hwcap2_SVE2 = 1 << 1 + hwcap2_SVEAES = 1 << 2 + hwcap2_SVEPMULL = 1 << 3 + hwcap2_SVEBITPERM = 1 << 4 + hwcap2_SVESHA3 = 1 << 5 + hwcap2_SVESM4 = 1 << 6 + hwcap2_FLAGM2 = 1 << 7 + hwcap2_FRINT = 1 << 8 + hwcap2_SVEI8MM = 1 << 9 + hwcap2_SVEF32MM = 1 << 10 + hwcap2_SVEF64MM = 1 << 11 + hwcap2_SVEBF16 = 1 << 12 + hwcap2_I8MM = 1 << 13 + hwcap2_BF16 = 1 << 14 + hwcap2_DGH = 1 << 15 + hwcap2_RNG = 1 << 16 + hwcap2_BTI = 1 << 17 + hwcap2_MTE = 1 << 18 + hwcap2_ECV = 1 << 19 + hwcap2_AFP = 1 << 20 + hwcap2_RPRES = 1 << 21 + hwcap2_MTE3 = 1 << 22 + hwcap2_SME = 1 << 23 + hwcap2_SME_I16I64 = 1 << 24 + hwcap2_SME_F64F64 = 1 << 25 + hwcap2_SME_I8I32 = 1 << 26 + hwcap2_SME_F16F32 = 1 << 27 + hwcap2_SME_B16F32 = 1 << 28 + hwcap2_SME_F32F32 = 1 << 29 + hwcap2_SME_FA64 = 1 << 30 + hwcap2_WFXT = 1 << 31 + hwcap2_EBF16 = 1 << 32 + hwcap2_SVE_EBF16 = 1 << 33 + hwcap2_CSSC = 1 << 34 + hwcap2_RPRFM = 1 << 35 + hwcap2_SVE2P1 = 1 << 36 + hwcap2_SME2 = 1 << 37 + hwcap2_SME2P1 = 1 << 38 + hwcap2_SME_I16I32 = 1 << 39 + hwcap2_SME_BI32I32 = 1 << 40 + hwcap2_SME_B16B16 = 1 << 41 + hwcap2_SME_F16F16 = 1 << 42 + hwcap2_MOPS = 1 << 43 + hwcap2_HBC = 1 << 44 + hwcap2_SVE_B16B16 = 1 << 45 + hwcap2_LRCPC3 = 1 << 46 + hwcap2_LSE128 = 1 << 47 + hwcap2_FPMR = 1 << 48 + hwcap2_LUT = 1 << 49 + hwcap2_FAMINMAX = 1 << 50 + hwcap2_F8CVT = 1 << 51 + hwcap2_F8FMA = 1 << 52 + hwcap2_F8DP4 = 1 << 53 + hwcap2_F8DP2 = 1 << 54 + hwcap2_F8E4M3 = 1 << 55 + hwcap2_F8E5M2 = 1 << 56 + hwcap2_SME_LUTV2 = 1 << 57 + hwcap2_SME_F8F16 = 1 << 58 + hwcap2_SME_F8F32 = 1 << 59 + hwcap2_SME_SF8FMA = 1 << 60 + hwcap2_SME_SF8DP4 = 1 << 61 + hwcap2_SME_SF8DP2 = 1 << 62 + hwcap2_POE = 1 << 63 ) func detectOS(c *CPUInfo) bool { @@ -104,11 +178,15 @@ func detectOS(c *CPUInfo) bool { c.featureSet.setIf(isSet(hwcap, hwcap_DCPOP), DCPOP) c.featureSet.setIf(isSet(hwcap, hwcap_EVTSTRM), EVTSTRM) c.featureSet.setIf(isSet(hwcap, hwcap_FCMA), FCMA) + c.featureSet.setIf(isSet(hwcap, hwcap_ASIMDFHM), FHM) c.featureSet.setIf(isSet(hwcap, hwcap_FP), FP) c.featureSet.setIf(isSet(hwcap, hwcap_FPHP), FPHP) c.featureSet.setIf(isSet(hwcap, hwcap_JSCVT), JSCVT) c.featureSet.setIf(isSet(hwcap, hwcap_LRCPC), LRCPC) c.featureSet.setIf(isSet(hwcap, hwcap_PMULL), PMULL) + c.featureSet.setIf(isSet(hwcap, hwcap2_RNG), RNDR) + // c.featureSet.setIf(isSet(hwcap, hwcap_), TLB) + // c.featureSet.setIf(isSet(hwcap, hwcap_), TS) c.featureSet.setIf(isSet(hwcap, hwcap_SHA1), SHA1) c.featureSet.setIf(isSet(hwcap, hwcap_SHA2), SHA2) c.featureSet.setIf(isSet(hwcap, hwcap_SHA3), SHA3) diff --git a/vendor/github.com/mailru/easyjson/jlexer/bytestostr.go b/vendor/github.com/mailru/easyjson/jlexer/bytestostr.go index ff7b27c5b20..e68108f8687 100644 --- a/vendor/github.com/mailru/easyjson/jlexer/bytestostr.go +++ b/vendor/github.com/mailru/easyjson/jlexer/bytestostr.go @@ -8,7 +8,6 @@ package jlexer import ( - "reflect" "unsafe" ) @@ -18,7 +17,5 @@ import ( // chunk may be either blocked from being freed by GC because of a single string or the buffer.Data // may be garbage-collected even when the string exists. func bytesToStr(data []byte) string { - h := (*reflect.SliceHeader)(unsafe.Pointer(&data)) - shdr := reflect.StringHeader{Data: h.Data, Len: h.Len} - return *(*string)(unsafe.Pointer(&shdr)) + return *(*string)(unsafe.Pointer(&data)) } diff --git a/vendor/github.com/mailru/easyjson/jlexer/lexer.go b/vendor/github.com/mailru/easyjson/jlexer/lexer.go index b5f5e261329..a27705b12b5 100644 --- a/vendor/github.com/mailru/easyjson/jlexer/lexer.go +++ b/vendor/github.com/mailru/easyjson/jlexer/lexer.go @@ -19,21 +19,21 @@ import ( "github.com/josharian/intern" ) -// tokenKind determines type of a token. -type tokenKind byte +// TokenKind determines type of a token. +type TokenKind byte const ( - tokenUndef tokenKind = iota // No token. - tokenDelim // Delimiter: one of '{', '}', '[' or ']'. - tokenString // A string literal, e.g. "abc\u1234" - tokenNumber // Number literal, e.g. 1.5e5 - tokenBool // Boolean literal: true or false. - tokenNull // null keyword. + TokenUndef TokenKind = iota // No token. + TokenDelim // Delimiter: one of '{', '}', '[' or ']'. + TokenString // A string literal, e.g. "abc\u1234" + TokenNumber // Number literal, e.g. 1.5e5 + TokenBool // Boolean literal: true or false. + TokenNull // null keyword. ) // token describes a single token: type, position in the input and value. type token struct { - kind tokenKind // Type of a token. + kind TokenKind // Type of a token. boolValue bool // Value if a boolean literal token. byteValueCloned bool // true if byteValue was allocated and does not refer to original json body @@ -47,7 +47,7 @@ type Lexer struct { start int // Start of the current token. pos int // Current unscanned position in the input stream. - token token // Last scanned token, if token.kind != tokenUndef. + token token // Last scanned token, if token.kind != TokenUndef. firstElement bool // Whether current element is the first in array or an object. wantSep byte // A comma or a colon character, which need to occur before a token. @@ -59,7 +59,7 @@ type Lexer struct { // FetchToken scans the input for the next token. func (r *Lexer) FetchToken() { - r.token.kind = tokenUndef + r.token.kind = TokenUndef r.start = r.pos // Check if r.Data has r.pos element @@ -90,7 +90,7 @@ func (r *Lexer) FetchToken() { r.errSyntax() } - r.token.kind = tokenString + r.token.kind = TokenString r.fetchString() return @@ -99,7 +99,7 @@ func (r *Lexer) FetchToken() { r.errSyntax() } r.firstElement = true - r.token.kind = tokenDelim + r.token.kind = TokenDelim r.token.delimValue = r.Data[r.pos] r.pos++ return @@ -109,7 +109,7 @@ func (r *Lexer) FetchToken() { r.errSyntax() } r.wantSep = 0 - r.token.kind = tokenDelim + r.token.kind = TokenDelim r.token.delimValue = r.Data[r.pos] r.pos++ return @@ -118,7 +118,7 @@ func (r *Lexer) FetchToken() { if r.wantSep != 0 { r.errSyntax() } - r.token.kind = tokenNumber + r.token.kind = TokenNumber r.fetchNumber() return @@ -127,7 +127,7 @@ func (r *Lexer) FetchToken() { r.errSyntax() } - r.token.kind = tokenNull + r.token.kind = TokenNull r.fetchNull() return @@ -136,7 +136,7 @@ func (r *Lexer) FetchToken() { r.errSyntax() } - r.token.kind = tokenBool + r.token.kind = TokenBool r.token.boolValue = true r.fetchTrue() return @@ -146,7 +146,7 @@ func (r *Lexer) FetchToken() { r.errSyntax() } - r.token.kind = tokenBool + r.token.kind = TokenBool r.token.boolValue = false r.fetchFalse() return @@ -391,7 +391,7 @@ func (r *Lexer) fetchString() { // scanToken scans the next token if no token is currently available in the lexer. func (r *Lexer) scanToken() { - if r.token.kind != tokenUndef || r.fatalError != nil { + if r.token.kind != TokenUndef || r.fatalError != nil { return } @@ -400,7 +400,7 @@ func (r *Lexer) scanToken() { // consume resets the current token to allow scanning the next one. func (r *Lexer) consume() { - r.token.kind = tokenUndef + r.token.kind = TokenUndef r.token.byteValueCloned = false r.token.delimValue = 0 } @@ -443,10 +443,10 @@ func (r *Lexer) errInvalidToken(expected string) { switch expected { case "[": r.token.delimValue = ']' - r.token.kind = tokenDelim + r.token.kind = TokenDelim case "{": r.token.delimValue = '}' - r.token.kind = tokenDelim + r.token.kind = TokenDelim } r.addNonfatalError(&LexerError{ Reason: fmt.Sprintf("expected %s", expected), @@ -475,7 +475,7 @@ func (r *Lexer) GetPos() int { // Delim consumes a token and verifies that it is the given delimiter. func (r *Lexer) Delim(c byte) { - if r.token.kind == tokenUndef && r.Ok() { + if r.token.kind == TokenUndef && r.Ok() { r.FetchToken() } @@ -489,7 +489,7 @@ func (r *Lexer) Delim(c byte) { // IsDelim returns true if there was no scanning error and next token is the given delimiter. func (r *Lexer) IsDelim(c byte) bool { - if r.token.kind == tokenUndef && r.Ok() { + if r.token.kind == TokenUndef && r.Ok() { r.FetchToken() } return !r.Ok() || r.token.delimValue == c @@ -497,10 +497,10 @@ func (r *Lexer) IsDelim(c byte) bool { // Null verifies that the next token is null and consumes it. func (r *Lexer) Null() { - if r.token.kind == tokenUndef && r.Ok() { + if r.token.kind == TokenUndef && r.Ok() { r.FetchToken() } - if !r.Ok() || r.token.kind != tokenNull { + if !r.Ok() || r.token.kind != TokenNull { r.errInvalidToken("null") } r.consume() @@ -508,15 +508,15 @@ func (r *Lexer) Null() { // IsNull returns true if the next token is a null keyword. func (r *Lexer) IsNull() bool { - if r.token.kind == tokenUndef && r.Ok() { + if r.token.kind == TokenUndef && r.Ok() { r.FetchToken() } - return r.Ok() && r.token.kind == tokenNull + return r.Ok() && r.token.kind == TokenNull } // Skip skips a single token. func (r *Lexer) Skip() { - if r.token.kind == tokenUndef && r.Ok() { + if r.token.kind == TokenUndef && r.Ok() { r.FetchToken() } r.consume() @@ -621,10 +621,10 @@ func (r *Lexer) Consumed() { } func (r *Lexer) unsafeString(skipUnescape bool) (string, []byte) { - if r.token.kind == tokenUndef && r.Ok() { + if r.token.kind == TokenUndef && r.Ok() { r.FetchToken() } - if !r.Ok() || r.token.kind != tokenString { + if !r.Ok() || r.token.kind != TokenString { r.errInvalidToken("string") return "", nil } @@ -664,10 +664,10 @@ func (r *Lexer) UnsafeFieldName(skipUnescape bool) string { // String reads a string literal. func (r *Lexer) String() string { - if r.token.kind == tokenUndef && r.Ok() { + if r.token.kind == TokenUndef && r.Ok() { r.FetchToken() } - if !r.Ok() || r.token.kind != tokenString { + if !r.Ok() || r.token.kind != TokenString { r.errInvalidToken("string") return "" } @@ -687,10 +687,10 @@ func (r *Lexer) String() string { // StringIntern reads a string literal, and performs string interning on it. func (r *Lexer) StringIntern() string { - if r.token.kind == tokenUndef && r.Ok() { + if r.token.kind == TokenUndef && r.Ok() { r.FetchToken() } - if !r.Ok() || r.token.kind != tokenString { + if !r.Ok() || r.token.kind != TokenString { r.errInvalidToken("string") return "" } @@ -705,10 +705,10 @@ func (r *Lexer) StringIntern() string { // Bytes reads a string literal and base64 decodes it into a byte slice. func (r *Lexer) Bytes() []byte { - if r.token.kind == tokenUndef && r.Ok() { + if r.token.kind == TokenUndef && r.Ok() { r.FetchToken() } - if !r.Ok() || r.token.kind != tokenString { + if !r.Ok() || r.token.kind != TokenString { r.errInvalidToken("string") return nil } @@ -731,10 +731,10 @@ func (r *Lexer) Bytes() []byte { // Bool reads a true or false boolean keyword. func (r *Lexer) Bool() bool { - if r.token.kind == tokenUndef && r.Ok() { + if r.token.kind == TokenUndef && r.Ok() { r.FetchToken() } - if !r.Ok() || r.token.kind != tokenBool { + if !r.Ok() || r.token.kind != TokenBool { r.errInvalidToken("bool") return false } @@ -744,10 +744,10 @@ func (r *Lexer) Bool() bool { } func (r *Lexer) number() string { - if r.token.kind == tokenUndef && r.Ok() { + if r.token.kind == TokenUndef && r.Ok() { r.FetchToken() } - if !r.Ok() || r.token.kind != tokenNumber { + if !r.Ok() || r.token.kind != TokenNumber { r.errInvalidToken("number") return "" } @@ -1151,7 +1151,7 @@ func (r *Lexer) GetNonFatalErrors() []*LexerError { // JsonNumber fetches and json.Number from 'encoding/json' package. // Both int, float or string, contains them are valid values func (r *Lexer) JsonNumber() json.Number { - if r.token.kind == tokenUndef && r.Ok() { + if r.token.kind == TokenUndef && r.Ok() { r.FetchToken() } if !r.Ok() { @@ -1160,11 +1160,11 @@ func (r *Lexer) JsonNumber() json.Number { } switch r.token.kind { - case tokenString: + case TokenString: return json.Number(r.String()) - case tokenNumber: + case TokenNumber: return json.Number(r.Raw()) - case tokenNull: + case TokenNull: r.Null() return json.Number("") default: @@ -1175,7 +1175,7 @@ func (r *Lexer) JsonNumber() json.Number { // Interface fetches an interface{} analogous to the 'encoding/json' package. func (r *Lexer) Interface() interface{} { - if r.token.kind == tokenUndef && r.Ok() { + if r.token.kind == TokenUndef && r.Ok() { r.FetchToken() } @@ -1183,13 +1183,13 @@ func (r *Lexer) Interface() interface{} { return nil } switch r.token.kind { - case tokenString: + case TokenString: return r.String() - case tokenNumber: + case TokenNumber: return r.Float64() - case tokenBool: + case TokenBool: return r.Bool() - case tokenNull: + case TokenNull: r.Null() return nil } @@ -1242,3 +1242,16 @@ func (r *Lexer) WantColon() { r.wantSep = ':' r.firstElement = false } + +// CurrentToken returns current token kind if there were no errors and TokenUndef otherwise +func (r *Lexer) CurrentToken() TokenKind { + if r.token.kind == TokenUndef && r.Ok() { + r.FetchToken() + } + + if !r.Ok() { + return TokenUndef + } + + return r.token.kind +} diff --git a/vendor/github.com/mailru/easyjson/jwriter/writer.go b/vendor/github.com/mailru/easyjson/jwriter/writer.go index 2c5b20105bb..34b0ade4685 100644 --- a/vendor/github.com/mailru/easyjson/jwriter/writer.go +++ b/vendor/github.com/mailru/easyjson/jwriter/writer.go @@ -67,6 +67,18 @@ func (w *Writer) RawString(s string) { w.Buffer.AppendString(s) } +// RawBytesString appends string from bytes to the buffer. +func (w *Writer) RawBytesString(data []byte, err error) { + switch { + case w.Error != nil: + return + case err != nil: + w.Error = err + default: + w.String(string(data)) + } +} + // Raw appends raw binary data to the buffer or sets the error if it is given. Useful for // calling with results of MarshalJSON-like functions. func (w *Writer) Raw(data []byte, err error) { diff --git a/vendor/github.com/minio/crc64nvme/LICENSE b/vendor/github.com/minio/crc64nvme/LICENSE new file mode 100644 index 00000000000..d6456956733 --- /dev/null +++ b/vendor/github.com/minio/crc64nvme/LICENSE @@ -0,0 +1,202 @@ + + Apache License + Version 2.0, January 2004 + http://www.apache.org/licenses/ + + TERMS AND CONDITIONS FOR USE, REPRODUCTION, AND DISTRIBUTION + + 1. Definitions. + + "License" shall mean the terms and conditions for use, reproduction, + and distribution as defined by Sections 1 through 9 of this document. + + "Licensor" shall mean the copyright owner or entity authorized by + the copyright owner that is granting the License. + + "Legal Entity" shall mean the union of the acting entity and all + other entities that control, are controlled by, or are under common + control with that entity. For the purposes of this definition, + "control" means (i) the power, direct or indirect, to cause the + direction or management of such entity, whether by contract or + otherwise, or (ii) ownership of fifty percent (50%) or more of the + outstanding shares, or (iii) beneficial ownership of such entity. + + "You" (or "Your") shall mean an individual or Legal Entity + exercising permissions granted by this License. + + "Source" form shall mean the preferred form for making modifications, + including but not limited to software source code, documentation + source, and configuration files. + + "Object" form shall mean any form resulting from mechanical + transformation or translation of a Source form, including but + not limited to compiled object code, generated documentation, + and conversions to other media types. + + "Work" shall mean the work of authorship, whether in Source or + Object form, made available under the License, as indicated by a + copyright notice that is included in or attached to the work + (an example is provided in the Appendix below). + + "Derivative Works" shall mean any work, whether in Source or Object + form, that is based on (or derived from) the Work and for which the + editorial revisions, annotations, elaborations, or other modifications + represent, as a whole, an original work of authorship. For the purposes + of this License, Derivative Works shall not include works that remain + separable from, or merely link (or bind by name) to the interfaces of, + the Work and Derivative Works thereof. + + "Contribution" shall mean any work of authorship, including + the original version of the Work and any modifications or additions + to that Work or Derivative Works thereof, that is intentionally + submitted to Licensor for inclusion in the Work by the copyright owner + or by an individual or Legal Entity authorized to submit on behalf of + the copyright owner. For the purposes of this definition, "submitted" + means any form of electronic, verbal, or written communication sent + to the Licensor or its representatives, including but not limited to + communication on electronic mailing lists, source code control systems, + and issue tracking systems that are managed by, or on behalf of, the + Licensor for the purpose of discussing and improving the Work, but + excluding communication that is conspicuously marked or otherwise + designated in writing by the copyright owner as "Not a Contribution." + + "Contributor" shall mean Licensor and any individual or Legal Entity + on behalf of whom a Contribution has been received by Licensor and + subsequently incorporated within the Work. + + 2. Grant of Copyright License. Subject to the terms and conditions of + this License, each Contributor hereby grants to You a perpetual, + worldwide, non-exclusive, no-charge, royalty-free, irrevocable + copyright license to reproduce, prepare Derivative Works of, + publicly display, publicly perform, sublicense, and distribute the + Work and such Derivative Works in Source or Object form. + + 3. Grant of Patent License. Subject to the terms and conditions of + this License, each Contributor hereby grants to You a perpetual, + worldwide, non-exclusive, no-charge, royalty-free, irrevocable + (except as stated in this section) patent license to make, have made, + use, offer to sell, sell, import, and otherwise transfer the Work, + where such license applies only to those patent claims licensable + by such Contributor that are necessarily infringed by their + Contribution(s) alone or by combination of their Contribution(s) + with the Work to which such Contribution(s) was submitted. If You + institute patent litigation against any entity (including a + cross-claim or counterclaim in a lawsuit) alleging that the Work + or a Contribution incorporated within the Work constitutes direct + or contributory patent infringement, then any patent licenses + granted to You under this License for that Work shall terminate + as of the date such litigation is filed. + + 4. Redistribution. You may reproduce and distribute copies of the + Work or Derivative Works thereof in any medium, with or without + modifications, and in Source or Object form, provided that You + meet the following conditions: + + (a) You must give any other recipients of the Work or + Derivative Works a copy of this License; and + + (b) You must cause any modified files to carry prominent notices + stating that You changed the files; and + + (c) You must retain, in the Source form of any Derivative Works + that You distribute, all copyright, patent, trademark, and + attribution notices from the Source form of the Work, + excluding those notices that do not pertain to any part of + the Derivative Works; and + + (d) If the Work includes a "NOTICE" text file as part of its + distribution, then any Derivative Works that You distribute must + include a readable copy of the attribution notices contained + within such NOTICE file, excluding those notices that do not + pertain to any part of the Derivative Works, in at least one + of the following places: within a NOTICE text file distributed + as part of the Derivative Works; within the Source form or + documentation, if provided along with the Derivative Works; or, + within a display generated by the Derivative Works, if and + wherever such third-party notices normally appear. The contents + of the NOTICE file are for informational purposes only and + do not modify the License. You may add Your own attribution + notices within Derivative Works that You distribute, alongside + or as an addendum to the NOTICE text from the Work, provided + that such additional attribution notices cannot be construed + as modifying the License. + + You may add Your own copyright statement to Your modifications and + may provide additional or different license terms and conditions + for use, reproduction, or distribution of Your modifications, or + for any such Derivative Works as a whole, provided Your use, + reproduction, and distribution of the Work otherwise complies with + the conditions stated in this License. + + 5. Submission of Contributions. Unless You explicitly state otherwise, + any Contribution intentionally submitted for inclusion in the Work + by You to the Licensor shall be under the terms and conditions of + this License, without any additional terms or conditions. + Notwithstanding the above, nothing herein shall supersede or modify + the terms of any separate license agreement you may have executed + with Licensor regarding such Contributions. + + 6. Trademarks. This License does not grant permission to use the trade + names, trademarks, service marks, or product names of the Licensor, + except as required for reasonable and customary use in describing the + origin of the Work and reproducing the content of the NOTICE file. + + 7. Disclaimer of Warranty. Unless required by applicable law or + agreed to in writing, Licensor provides the Work (and each + Contributor provides its Contributions) on an "AS IS" BASIS, + WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or + implied, including, without limitation, any warranties or conditions + of TITLE, NON-INFRINGEMENT, MERCHANTABILITY, or FITNESS FOR A + PARTICULAR PURPOSE. You are solely responsible for determining the + appropriateness of using or redistributing the Work and assume any + risks associated with Your exercise of permissions under this License. + + 8. Limitation of Liability. In no event and under no legal theory, + whether in tort (including negligence), contract, or otherwise, + unless required by applicable law (such as deliberate and grossly + negligent acts) or agreed to in writing, shall any Contributor be + liable to You for damages, including any direct, indirect, special, + incidental, or consequential damages of any character arising as a + result of this License or out of the use or inability to use the + Work (including but not limited to damages for loss of goodwill, + work stoppage, computer failure or malfunction, or any and all + other commercial damages or losses), even if such Contributor + has been advised of the possibility of such damages. + + 9. Accepting Warranty or Additional Liability. While redistributing + the Work or Derivative Works thereof, You may choose to offer, + and charge a fee for, acceptance of support, warranty, indemnity, + or other liability obligations and/or rights consistent with this + License. However, in accepting such obligations, You may act only + on Your own behalf and on Your sole responsibility, not on behalf + of any other Contributor, and only if You agree to indemnify, + defend, and hold each Contributor harmless for any liability + incurred by, or claims asserted against, such Contributor by reason + of your accepting any such warranty or additional liability. + + END OF TERMS AND CONDITIONS + + APPENDIX: How to apply the Apache License to your work. + + To apply the Apache License to your work, attach the following + boilerplate notice, with the fields enclosed by brackets "[]" + replaced with your own identifying information. (Don't include + the brackets!) The text should be enclosed in the appropriate + comment syntax for the file format. We also recommend that a + file or class name and description of purpose be included on the + same "printed page" as the copyright notice for easier + identification within third-party archives. + + Copyright [yyyy] [name of copyright owner] + + Licensed under the Apache License, Version 2.0 (the "License"); + you may not use this file except in compliance with the License. + You may obtain a copy of the License at + + http://www.apache.org/licenses/LICENSE-2.0 + + Unless required by applicable law or agreed to in writing, software + distributed under the License is distributed on an "AS IS" BASIS, + WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. + See the License for the specific language governing permissions and + limitations under the License. diff --git a/vendor/github.com/minio/crc64nvme/README.md b/vendor/github.com/minio/crc64nvme/README.md new file mode 100644 index 00000000000..977dfcc8818 --- /dev/null +++ b/vendor/github.com/minio/crc64nvme/README.md @@ -0,0 +1,20 @@ + +## crc64nvme + +This Golang package calculates CRC64 checksums using carryless-multiplication accelerated with SIMD instructions for both ARM and x86. It is based on the NVME polynomial as specified in the [NVM Express® NVM Command Set Specification](https://nvmexpress.org/wp-content/uploads/NVM-Express-NVM-Command-Set-Specification-1.0d-2023.12.28-Ratified.pdf). + +The code is based on the [crc64fast-nvme](https://github.com/awesomized/crc64fast-nvme.git) package in Rust and is released under the Apache 2.0 license. + +For more background on the exact technique used, see this [Fast CRC Computation for Generic Polynomials Using PCLMULQDQ Instruction](https://web.archive.org/web/20131224125630/https://www.intel.com/content/dam/www/public/us/en/documents/white-papers/fast-crc-computation-generic-polynomials-pclmulqdq-paper.pdf) paper. + +### Performance + +To follow. + +### Requirements + +All Go versions >= 1.22 are supported. + +### Contributing + +Contributions are welcome, please send PRs for any enhancements. diff --git a/vendor/github.com/minio/crc64nvme/crc64.go b/vendor/github.com/minio/crc64nvme/crc64.go new file mode 100644 index 00000000000..40ac28c7655 --- /dev/null +++ b/vendor/github.com/minio/crc64nvme/crc64.go @@ -0,0 +1,180 @@ +// Copyright (c) 2025 Minio Inc. All rights reserved. +// Use of this source code is governed by a license that can be +// found in the LICENSE file. + +// Package crc64nvme implements the 64-bit cyclic redundancy check with NVME polynomial. +package crc64nvme + +import ( + "encoding/binary" + "errors" + "hash" + "sync" + "unsafe" +) + +const ( + // The size of a CRC-64 checksum in bytes. + Size = 8 + + // The NVME polynoimial (reversed, as used by Go) + NVME = 0x9a6c9329ac4bc9b5 +) + +var ( + // precalculated table. + nvmeTable = makeTable(NVME) +) + +// table is a 256-word table representing the polynomial for efficient processing. +type table [256]uint64 + +var ( + slicing8TablesBuildOnce sync.Once + slicing8TableNVME *[8]table +) + +func buildSlicing8TablesOnce() { + slicing8TablesBuildOnce.Do(buildSlicing8Tables) +} + +func buildSlicing8Tables() { + slicing8TableNVME = makeSlicingBy8Table(makeTable(NVME)) +} + +func makeTable(poly uint64) *table { + t := new(table) + for i := 0; i < 256; i++ { + crc := uint64(i) + for j := 0; j < 8; j++ { + if crc&1 == 1 { + crc = (crc >> 1) ^ poly + } else { + crc >>= 1 + } + } + t[i] = crc + } + return t +} + +func makeSlicingBy8Table(t *table) *[8]table { + var helperTable [8]table + helperTable[0] = *t + for i := 0; i < 256; i++ { + crc := t[i] + for j := 1; j < 8; j++ { + crc = t[crc&0xff] ^ (crc >> 8) + helperTable[j][i] = crc + } + } + return &helperTable +} + +// digest represents the partial evaluation of a checksum. +type digest struct { + crc uint64 +} + +// New creates a new hash.Hash64 computing the CRC-64 checksum using the +// NVME polynomial. Its Sum method will lay the +// value out in big-endian byte order. The returned Hash64 also +// implements [encoding.BinaryMarshaler] and [encoding.BinaryUnmarshaler] to +// marshal and unmarshal the internal state of the hash. +func New() hash.Hash64 { return &digest{0} } + +func (d *digest) Size() int { return Size } + +func (d *digest) BlockSize() int { return 1 } + +func (d *digest) Reset() { d.crc = 0 } + +const ( + magic = "crc\x02" + marshaledSize = len(magic) + 8 + 8 +) + +func (d *digest) MarshalBinary() ([]byte, error) { + b := make([]byte, 0, marshaledSize) + b = append(b, magic...) + b = binary.BigEndian.AppendUint64(b, tableSum) + b = binary.BigEndian.AppendUint64(b, d.crc) + return b, nil +} + +func (d *digest) UnmarshalBinary(b []byte) error { + if len(b) < len(magic) || string(b[:len(magic)]) != magic { + return errors.New("hash/crc64: invalid hash state identifier") + } + if len(b) != marshaledSize { + return errors.New("hash/crc64: invalid hash state size") + } + if tableSum != binary.BigEndian.Uint64(b[4:]) { + return errors.New("hash/crc64: tables do not match") + } + d.crc = binary.BigEndian.Uint64(b[12:]) + return nil +} + +func update(crc uint64, p []byte) uint64 { + if hasAsm && len(p) > 127 { + ptr := unsafe.Pointer(&p[0]) + if align := (uintptr(ptr)+15)&^0xf - uintptr(ptr); align > 0 { + // Align to 16-byte boundary. + crc = update(crc, p[:align]) + p = p[align:] + } + runs := len(p) / 128 + crc = updateAsm(crc, p[:128*runs]) + return update(crc, p[128*runs:]) + } + + buildSlicing8TablesOnce() + crc = ^crc + // table comparison is somewhat expensive, so avoid it for small sizes + for len(p) >= 64 { + var helperTable = slicing8TableNVME + // Update using slicing-by-8 + for len(p) > 8 { + crc ^= binary.LittleEndian.Uint64(p) + crc = helperTable[7][crc&0xff] ^ + helperTable[6][(crc>>8)&0xff] ^ + helperTable[5][(crc>>16)&0xff] ^ + helperTable[4][(crc>>24)&0xff] ^ + helperTable[3][(crc>>32)&0xff] ^ + helperTable[2][(crc>>40)&0xff] ^ + helperTable[1][(crc>>48)&0xff] ^ + helperTable[0][crc>>56] + p = p[8:] + } + } + // For reminders or small sizes + for _, v := range p { + crc = nvmeTable[byte(crc)^v] ^ (crc >> 8) + } + return ^crc +} + +// Update returns the result of adding the bytes in p to the crc. +func Update(crc uint64, p []byte) uint64 { + return update(crc, p) +} + +func (d *digest) Write(p []byte) (n int, err error) { + d.crc = update(d.crc, p) + return len(p), nil +} + +func (d *digest) Sum64() uint64 { return d.crc } + +func (d *digest) Sum(in []byte) []byte { + s := d.Sum64() + return append(in, byte(s>>56), byte(s>>48), byte(s>>40), byte(s>>32), byte(s>>24), byte(s>>16), byte(s>>8), byte(s)) +} + +// Checksum returns the CRC-64 checksum of data +// using the NVME polynomial. +func Checksum(data []byte) uint64 { return update(0, data) } + +// ISO tablesum of NVME poly +const tableSum = 0x8ddd9ee4402c7163 diff --git a/vendor/github.com/minio/crc64nvme/crc64_amd64.go b/vendor/github.com/minio/crc64nvme/crc64_amd64.go new file mode 100644 index 00000000000..fc8538bc3e3 --- /dev/null +++ b/vendor/github.com/minio/crc64nvme/crc64_amd64.go @@ -0,0 +1,15 @@ +// Copyright (c) 2025 Minio Inc. All rights reserved. +// Use of this source code is governed by a license that can be +// found in the LICENSE file. + +//go:build !noasm && !appengine && !gccgo + +package crc64nvme + +import ( + "github.com/klauspost/cpuid/v2" +) + +var hasAsm = cpuid.CPU.Supports(cpuid.SSE2, cpuid.CLMUL, cpuid.SSE4) + +func updateAsm(crc uint64, p []byte) (checksum uint64) diff --git a/vendor/github.com/minio/crc64nvme/crc64_amd64.s b/vendor/github.com/minio/crc64nvme/crc64_amd64.s new file mode 100644 index 00000000000..9782321fd0c --- /dev/null +++ b/vendor/github.com/minio/crc64nvme/crc64_amd64.s @@ -0,0 +1,157 @@ +// Copyright (c) 2025 Minio Inc. All rights reserved. +// Use of this source code is governed by a license that can be +// found in the LICENSE file. + +//go:build !noasm && !appengine && !gccgo + +#include "textflag.h" + +TEXT ·updateAsm(SB), $0-40 + MOVQ crc+0(FP), AX // checksum + MOVQ p_base+8(FP), SI // start pointer + MOVQ p_len+16(FP), CX // length of buffer + NOTQ AX + SHRQ $7, CX + CMPQ CX, $1 + JLT skip128 + + VMOVDQA 0x00(SI), X0 + VMOVDQA 0x10(SI), X1 + VMOVDQA 0x20(SI), X2 + VMOVDQA 0x30(SI), X3 + VMOVDQA 0x40(SI), X4 + VMOVDQA 0x50(SI), X5 + VMOVDQA 0x60(SI), X6 + VMOVDQA 0x70(SI), X7 + MOVQ AX, X8 + PXOR X8, X0 + CMPQ CX, $1 + JE tail128 + + MOVQ $0xa1ca681e733f9c40, AX + MOVQ AX, X8 + MOVQ $0x5f852fb61e8d92dc, AX + PINSRQ $0x1, AX, X9 + +loop128: + ADDQ $128, SI + SUBQ $1, CX + VMOVDQA X0, X10 + PCLMULQDQ $0x00, X8, X10 + PCLMULQDQ $0x11, X9, X0 + PXOR X10, X0 + PXOR 0(SI), X0 + VMOVDQA X1, X10 + PCLMULQDQ $0x00, X8, X10 + PCLMULQDQ $0x11, X9, X1 + PXOR X10, X1 + PXOR 0x10(SI), X1 + VMOVDQA X2, X10 + PCLMULQDQ $0x00, X8, X10 + PCLMULQDQ $0x11, X9, X2 + PXOR X10, X2 + PXOR 0x20(SI), X2 + VMOVDQA X3, X10 + PCLMULQDQ $0x00, X8, X10 + PCLMULQDQ $0x11, X9, X3 + PXOR X10, X3 + PXOR 0x30(SI), X3 + VMOVDQA X4, X10 + PCLMULQDQ $0x00, X8, X10 + PCLMULQDQ $0x11, X9, X4 + PXOR X10, X4 + PXOR 0x40(SI), X4 + VMOVDQA X5, X10 + PCLMULQDQ $0x00, X8, X10 + PCLMULQDQ $0x11, X9, X5 + PXOR X10, X5 + PXOR 0x50(SI), X5 + VMOVDQA X6, X10 + PCLMULQDQ $0x00, X8, X10 + PCLMULQDQ $0x11, X9, X6 + PXOR X10, X6 + PXOR 0x60(SI), X6 + VMOVDQA X7, X10 + PCLMULQDQ $0x00, X8, X10 + PCLMULQDQ $0x11, X9, X7 + PXOR X10, X7 + PXOR 0x70(SI), X7 + CMPQ CX, $1 + JGT loop128 + +tail128: + MOVQ $0xd083dd594d96319d, AX + MOVQ AX, X11 + PCLMULQDQ $0x00, X0, X11 + MOVQ $0x946588403d4adcbc, AX + PINSRQ $0x1, AX, X12 + PCLMULQDQ $0x11, X12, X0 + PXOR X11, X7 + PXOR X0, X7 + MOVQ $0x3c255f5ebc414423, AX + MOVQ AX, X11 + PCLMULQDQ $0x00, X1, X11 + MOVQ $0x34f5a24e22d66e90, AX + PINSRQ $0x1, AX, X12 + PCLMULQDQ $0x11, X12, X1 + PXOR X11, X1 + PXOR X7, X1 + MOVQ $0x7b0ab10dd0f809fe, AX + MOVQ AX, X11 + PCLMULQDQ $0x00, X2, X11 + MOVQ $0x03363823e6e791e5, AX + PINSRQ $0x1, AX, X12 + PCLMULQDQ $0x11, X12, X2 + PXOR X11, X2 + PXOR X1, X2 + MOVQ $0x0c32cdb31e18a84a, AX + MOVQ AX, X11 + PCLMULQDQ $0x00, X3, X11 + MOVQ $0x62242240ace5045a, AX + PINSRQ $0x1, AX, X12 + PCLMULQDQ $0x11, X12, X3 + PXOR X11, X3 + PXOR X2, X3 + MOVQ $0xbdd7ac0ee1a4a0f0, AX + MOVQ AX, X11 + PCLMULQDQ $0x00, X4, X11 + MOVQ $0xa3ffdc1fe8e82a8b, AX + PINSRQ $0x1, AX, X12 + PCLMULQDQ $0x11, X12, X4 + PXOR X11, X4 + PXOR X3, X4 + MOVQ $0xb0bc2e589204f500, AX + MOVQ AX, X11 + PCLMULQDQ $0x00, X5, X11 + MOVQ $0xe1e0bb9d45d7a44c, AX + PINSRQ $0x1, AX, X12 + PCLMULQDQ $0x11, X12, X5 + PXOR X11, X5 + PXOR X4, X5 + MOVQ $0xeadc41fd2ba3d420, AX + MOVQ AX, X11 + PCLMULQDQ $0x00, X6, X11 + MOVQ $0x21e9761e252621ac, AX + PINSRQ $0x1, AX, X12 + PCLMULQDQ $0x11, X12, X6 + PXOR X11, X6 + PXOR X5, X6 + MOVQ AX, X5 + PCLMULQDQ $0x00, X6, X5 + PSHUFD $0xee, X6, X6 + PXOR X5, X6 + MOVQ $0x27ecfa329aef9f77, AX + MOVQ AX, X4 + PCLMULQDQ $0x00, X4, X6 + PEXTRQ $0, X6, BX + MOVQ $0x34d926535897936b, AX + MOVQ AX, X4 + PCLMULQDQ $0x00, X4, X6 + PXOR X5, X6 + PEXTRQ $1, X6, AX + XORQ BX, AX + +skip128: + NOTQ AX + MOVQ AX, checksum+32(FP) + RET diff --git a/vendor/github.com/minio/crc64nvme/crc64_arm64.go b/vendor/github.com/minio/crc64nvme/crc64_arm64.go new file mode 100644 index 00000000000..c77c819ce0c --- /dev/null +++ b/vendor/github.com/minio/crc64nvme/crc64_arm64.go @@ -0,0 +1,15 @@ +// Copyright (c) 2025 Minio Inc. All rights reserved. +// Use of this source code is governed by a license that can be +// found in the LICENSE file. + +//go:build !noasm && !appengine && !gccgo + +package crc64nvme + +import ( + "github.com/klauspost/cpuid/v2" +) + +var hasAsm = cpuid.CPU.Supports(cpuid.ASIMD) && cpuid.CPU.Supports(cpuid.PMULL) + +func updateAsm(crc uint64, p []byte) (checksum uint64) diff --git a/vendor/github.com/minio/crc64nvme/crc64_arm64.s b/vendor/github.com/minio/crc64nvme/crc64_arm64.s new file mode 100644 index 00000000000..229a10fb734 --- /dev/null +++ b/vendor/github.com/minio/crc64nvme/crc64_arm64.s @@ -0,0 +1,157 @@ +// Copyright (c) 2025 Minio Inc. All rights reserved. +// Use of this source code is governed by a license that can be +// found in the LICENSE file. + +//go:build !noasm && !appengine && !gccgo + +#include "textflag.h" + +TEXT ·updateAsm(SB), $0-40 + MOVD crc+0(FP), R0 // checksum + MOVD p_base+8(FP), R1 // start pointer + MOVD p_len+16(FP), R2 // length of buffer + MOVD $·const(SB), R3 // constants + MVN R0, R0 + LSR $7, R2, R2 + CMP $1, R2 + BLT skip128 + + FLDPQ (R1), (F0, F1) + FLDPQ 32(R1), (F2, F3) + FLDPQ 64(R1), (F4, F5) + FLDPQ 96(R1), (F6, F7) + FMOVD R0, F8 + VMOVI $0, V9.B16 + VMOV V9.D[0], V8.D[1] + VEOR V8.B16, V0.B16, V0.B16 + CMP $1, R2 + BEQ tail128 + + MOVD 112(R3), R4 + MOVD 120(R3), R5 + FMOVD R4, F8 + VDUP R5, V9.D2 + +loop128: + ADD $128, R1, R1 + SUB $1, R2, R2 + VPMULL V0.D1, V8.D1, V10.Q1 + VPMULL2 V0.D2, V9.D2, V0.Q1 + FLDPQ (R1), (F11, F12) + VEOR3 V0.B16, V11.B16, V10.B16, V0.B16 + VPMULL V1.D1, V8.D1, V10.Q1 + VPMULL2 V1.D2, V9.D2, V1.Q1 + VEOR3 V1.B16, V12.B16, V10.B16, V1.B16 + VPMULL V2.D1, V8.D1, V10.Q1 + VPMULL2 V2.D2, V9.D2, V2.Q1 + FLDPQ 32(R1), (F11, F12) + VEOR3 V2.B16, V11.B16, V10.B16, V2.B16 + VPMULL V3.D1, V8.D1, V10.Q1 + VPMULL2 V3.D2, V9.D2, V3.Q1 + VEOR3 V3.B16, V12.B16, V10.B16, V3.B16 + VPMULL V4.D1, V8.D1, V10.Q1 + VPMULL2 V4.D2, V9.D2, V4.Q1 + FLDPQ 64(R1), (F11, F12) + VEOR3 V4.B16, V11.B16, V10.B16, V4.B16 + VPMULL V5.D1, V8.D1, V10.Q1 + VPMULL2 V5.D2, V9.D2, V5.Q1 + VEOR3 V5.B16, V12.B16, V10.B16, V5.B16 + VPMULL V6.D1, V8.D1, V10.Q1 + VPMULL2 V6.D2, V9.D2, V6.Q1 + FLDPQ 96(R1), (F11, F12) + VEOR3 V6.B16, V11.B16, V10.B16, V6.B16 + VPMULL V7.D1, V8.D1, V10.Q1 + VPMULL2 V7.D2, V9.D2, V7.Q1 + VEOR3 V7.B16, V12.B16, V10.B16, V7.B16 + CMP $1, R2 + BHI loop128 + +tail128: + MOVD (R3), R4 + FMOVD R4, F11 + VPMULL V0.D1, V11.D1, V11.Q1 + MOVD 8(R3), R4 + VDUP R4, V12.D2 + VPMULL2 V0.D2, V12.D2, V0.Q1 + VEOR3 V0.B16, V7.B16, V11.B16, V7.B16 + MOVD 16(R3), R4 + FMOVD R4, F11 + VPMULL V1.D1, V11.D1, V11.Q1 + MOVD 24(R3), R4 + VDUP R4, V12.D2 + VPMULL2 V1.D2, V12.D2, V1.Q1 + VEOR3 V1.B16, V11.B16, V7.B16, V1.B16 + MOVD 32(R3), R4 + FMOVD R4, F11 + VPMULL V2.D1, V11.D1, V11.Q1 + MOVD 40(R3), R4 + VDUP R4, V12.D2 + VPMULL2 V2.D2, V12.D2, V2.Q1 + VEOR3 V2.B16, V11.B16, V1.B16, V2.B16 + MOVD 48(R3), R4 + FMOVD R4, F11 + VPMULL V3.D1, V11.D1, V11.Q1 + MOVD 56(R3), R4 + VDUP R4, V12.D2 + VPMULL2 V3.D2, V12.D2, V3.Q1 + VEOR3 V3.B16, V11.B16, V2.B16, V3.B16 + MOVD 64(R3), R4 + FMOVD R4, F11 + VPMULL V4.D1, V11.D1, V11.Q1 + MOVD 72(R3), R4 + VDUP R4, V12.D2 + VPMULL2 V4.D2, V12.D2, V4.Q1 + VEOR3 V4.B16, V11.B16, V3.B16, V4.B16 + MOVD 80(R3), R4 + FMOVD R4, F11 + VPMULL V5.D1, V11.D1, V11.Q1 + MOVD 88(R3), R4 + VDUP R4, V12.D2 + VPMULL2 V5.D2, V12.D2, V5.Q1 + VEOR3 V5.B16, V11.B16, V4.B16, V5.B16 + MOVD 96(R3), R4 + FMOVD R4, F11 + VPMULL V6.D1, V11.D1, V11.Q1 + MOVD 104(R3), R4 + VDUP R4, V12.D2 + VPMULL2 V6.D2, V12.D2, V6.Q1 + VEOR3 V6.B16, V11.B16, V5.B16, V6.B16 + FMOVD R4, F5 + VPMULL V6.D1, V5.D1, V5.Q1 + VDUP V6.D[1], V6.D2 + VEOR V5.B8, V6.B8, V6.B8 + MOVD 128(R3), R4 + FMOVD R4, F4 + VPMULL V4.D1, V6.D1, V6.Q1 + FMOVD F6, R4 + MOVD 136(R3), R5 + FMOVD R5, F4 + VPMULL V4.D1, V6.D1, V6.Q1 + VEOR V6.B16, V5.B16, V6.B16 + VMOV V6.D[1], R5 + EOR R4, R5, R0 + +skip128: + MVN R0, R0 + MOVD R0, checksum+32(FP) + RET + +DATA ·const+0x000(SB)/8, $0xd083dd594d96319d // K_959 +DATA ·const+0x008(SB)/8, $0x946588403d4adcbc // K_895 +DATA ·const+0x010(SB)/8, $0x3c255f5ebc414423 // K_831 +DATA ·const+0x018(SB)/8, $0x34f5a24e22d66e90 // K_767 +DATA ·const+0x020(SB)/8, $0x7b0ab10dd0f809fe // K_703 +DATA ·const+0x028(SB)/8, $0x03363823e6e791e5 // K_639 +DATA ·const+0x030(SB)/8, $0x0c32cdb31e18a84a // K_575 +DATA ·const+0x038(SB)/8, $0x62242240ace5045a // K_511 +DATA ·const+0x040(SB)/8, $0xbdd7ac0ee1a4a0f0 // K_447 +DATA ·const+0x048(SB)/8, $0xa3ffdc1fe8e82a8b // K_383 +DATA ·const+0x050(SB)/8, $0xb0bc2e589204f500 // K_319 +DATA ·const+0x058(SB)/8, $0xe1e0bb9d45d7a44c // K_255 +DATA ·const+0x060(SB)/8, $0xeadc41fd2ba3d420 // K_191 +DATA ·const+0x068(SB)/8, $0x21e9761e252621ac // K_127 +DATA ·const+0x070(SB)/8, $0xa1ca681e733f9c40 // K_1087 +DATA ·const+0x078(SB)/8, $0x5f852fb61e8d92dc // K_1023 +DATA ·const+0x080(SB)/8, $0x27ecfa329aef9f77 // MU +DATA ·const+0x088(SB)/8, $0x34d926535897936b // POLY +GLOBL ·const(SB), (NOPTR+RODATA), $144 diff --git a/vendor/github.com/minio/crc64nvme/crc64_other.go b/vendor/github.com/minio/crc64nvme/crc64_other.go new file mode 100644 index 00000000000..467958c69dd --- /dev/null +++ b/vendor/github.com/minio/crc64nvme/crc64_other.go @@ -0,0 +1,11 @@ +// Copyright (c) 2025 Minio Inc. All rights reserved. +// Use of this source code is governed by a license that can be +// found in the LICENSE file. + +//go:build (!amd64 || noasm || appengine || gccgo) && (!arm64 || noasm || appengine || gccgo) + +package crc64nvme + +var hasAsm = false + +func updateAsm(crc uint64, p []byte) (checksum uint64) { panic("should not be reached") } diff --git a/vendor/github.com/minio/minio-go/v7/.golangci.yml b/vendor/github.com/minio/minio-go/v7/.golangci.yml index 875b949c6dd..88442e0cfef 100644 --- a/vendor/github.com/minio/minio-go/v7/.golangci.yml +++ b/vendor/github.com/minio/minio-go/v7/.golangci.yml @@ -1,27 +1,72 @@ -linters-settings: - misspell: - locale: US - +version: "2" linters: disable-all: true enable: - - typecheck - - goimports - - misspell - - revive + - durationcheck + - gocritic + - gomodguard - govet - ineffassign - - gosimple + - misspell + - revive + - staticcheck + - unconvert - unused - - gocritic - + - usetesting + - whitespace + settings: + misspell: + locale: US + staticcheck: + checks: + - all + - -SA1008 + - -SA1019 + - -SA4000 + - -SA9004 + - -ST1000 + - -ST1005 + - -ST1016 + - -ST1021 + - -ST1020 + - -U1000 + exclusions: + generated: lax + rules: + - path: (.+)\.go$ + text: "empty-block:" + - path: (.+)\.go$ + text: "unused-parameter:" + - path: (.+)\.go$ + text: "dot-imports:" + - path: (.+)\.go$ + text: "singleCaseSwitch: should rewrite switch statement to if statement" + - path: (.+)\.go$ + text: "unlambda: replace" + - path: (.+)\.go$ + text: "captLocal:" + - path: (.+)\.go$ + text: "should have a package comment" + - path: (.+)\.go$ + text: "ifElseChain:" + - path: (.+)\.go$ + text: "elseif:" + - path: (.+)\.go$ + text: "Error return value of" + - path: (.+)\.go$ + text: "unnecessary conversion" + - path: (.+)\.go$ + text: "Error return value is not checked" issues: - exclude-use-default: false - exclude: - # todo fix these when we get enough time. - - "singleCaseSwitch: should rewrite switch statement to if statement" - - "unlambda: replace" - - "captLocal:" - - "ifElseChain:" - - "elseif:" - - "should have a package comment" + max-issues-per-linter: 100 + max-same-issues: 100 +formatters: + enable: + - gofumpt + - goimports + exclusions: + generated: lax + paths: + - third_party$ + - builtin$ + - examples$ diff --git a/vendor/github.com/minio/minio-go/v7/api-append-object.go b/vendor/github.com/minio/minio-go/v7/api-append-object.go new file mode 100644 index 00000000000..fca08c3733e --- /dev/null +++ b/vendor/github.com/minio/minio-go/v7/api-append-object.go @@ -0,0 +1,226 @@ +/* + * MinIO Go Library for Amazon S3 Compatible Cloud Storage + * Copyright 2015-2025 MinIO, Inc. + * + * Licensed under the Apache License, Version 2.0 (the "License"); + * you may not use this file except in compliance with the License. + * You may obtain a copy of the License at + * + * http://www.apache.org/licenses/LICENSE-2.0 + * + * Unless required by applicable law or agreed to in writing, software + * distributed under the License is distributed on an "AS IS" BASIS, + * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. + * See the License for the specific language governing permissions and + * limitations under the License. + */ + +package minio + +import ( + "bytes" + "context" + "errors" + "fmt" + "io" + "net/http" + "strconv" + + "github.com/minio/minio-go/v7/pkg/s3utils" +) + +// AppendObjectOptions https://docs.aws.amazon.com/AmazonS3/latest/userguide/directory-buckets-objects-append.html +type AppendObjectOptions struct { + // Provide a progress reader to indicate the current append() progress. + Progress io.Reader + // ChunkSize indicates the maximum append() size, + // it is useful when you want to control how much data + // per append() you are interested in sending to server + // while keeping the input io.Reader of a longer length. + ChunkSize uint64 + // Aggressively disable sha256 payload, it is automatically + // turned-off for TLS supporting endpoints, useful in benchmarks + // where you are interested in the peak() numbers. + DisableContentSha256 bool + + customHeaders http.Header + checksumType ChecksumType +} + +// Header returns the custom header for AppendObject API +func (opts AppendObjectOptions) Header() (header http.Header) { + header = make(http.Header) + for k, v := range opts.customHeaders { + header[k] = v + } + return header +} + +func (opts *AppendObjectOptions) setWriteOffset(offset int64) { + if len(opts.customHeaders) == 0 { + opts.customHeaders = make(http.Header) + } + opts.customHeaders["x-amz-write-offset-bytes"] = []string{strconv.FormatInt(offset, 10)} +} + +func (opts *AppendObjectOptions) setChecksumParams(info ObjectInfo) { + if len(opts.customHeaders) == 0 { + opts.customHeaders = make(http.Header) + } + fullObject := info.ChecksumMode == ChecksumFullObjectMode.String() + switch { + case info.ChecksumCRC32 != "": + if fullObject { + opts.checksumType = ChecksumFullObjectCRC32 + } + case info.ChecksumCRC32C != "": + if fullObject { + opts.checksumType = ChecksumFullObjectCRC32C + } + case info.ChecksumCRC64NVME != "": + // CRC64NVME only has a full object variant + // so it does not carry any special full object + // modifier + opts.checksumType = ChecksumCRC64NVME + } +} + +func (opts AppendObjectOptions) validate(c *Client) (err error) { + if opts.ChunkSize > maxPartSize { + return errInvalidArgument("Append chunkSize cannot be larger than max part size allowed") + } + switch { + case !c.trailingHeaderSupport: + return errInvalidArgument("AppendObject() requires Client with TrailingHeaders enabled") + case c.overrideSignerType.IsV2(): + return errInvalidArgument("AppendObject() cannot be used with v2 signatures") + case s3utils.IsGoogleEndpoint(*c.endpointURL): + return errInvalidArgument("AppendObject() cannot be used with GCS endpoints") + } + + return nil +} + +// appendObjectDo - executes the append object http operation. +// NOTE: You must have WRITE permissions on a bucket to add an object to it. +func (c *Client) appendObjectDo(ctx context.Context, bucketName, objectName string, reader io.Reader, size int64, opts AppendObjectOptions) (UploadInfo, error) { + // Input validation. + if err := s3utils.CheckValidBucketName(bucketName); err != nil { + return UploadInfo{}, err + } + if err := s3utils.CheckValidObjectName(objectName); err != nil { + return UploadInfo{}, err + } + + // Set headers. + customHeader := opts.Header() + + // Populate request metadata. + reqMetadata := requestMetadata{ + bucketName: bucketName, + objectName: objectName, + customHeader: customHeader, + contentBody: reader, + contentLength: size, + streamSha256: !opts.DisableContentSha256, + } + + if opts.checksumType.IsSet() { + reqMetadata.addCrc = &opts.checksumType + } + + // Execute PUT an objectName. + resp, err := c.executeMethod(ctx, http.MethodPut, reqMetadata) + defer closeResponse(resp) + if err != nil { + return UploadInfo{}, err + } + if resp != nil { + if resp.StatusCode != http.StatusOK { + return UploadInfo{}, httpRespToErrorResponse(resp, bucketName, objectName) + } + } + + h := resp.Header + + // When AppendObject() is used, S3 Express will return final object size as x-amz-object-size + if amzSize := h.Get("x-amz-object-size"); amzSize != "" { + size, err = strconv.ParseInt(amzSize, 10, 64) + if err != nil { + return UploadInfo{}, err + } + } + + return UploadInfo{ + Bucket: bucketName, + Key: objectName, + ETag: trimEtag(h.Get("ETag")), + Size: size, + + // Checksum values + ChecksumCRC32: h.Get(ChecksumCRC32.Key()), + ChecksumCRC32C: h.Get(ChecksumCRC32C.Key()), + ChecksumSHA1: h.Get(ChecksumSHA1.Key()), + ChecksumSHA256: h.Get(ChecksumSHA256.Key()), + ChecksumCRC64NVME: h.Get(ChecksumCRC64NVME.Key()), + ChecksumMode: h.Get(ChecksumFullObjectMode.Key()), + }, nil +} + +// AppendObject - S3 Express Zone https://docs.aws.amazon.com/AmazonS3/latest/userguide/directory-buckets-objects-append.html +func (c *Client) AppendObject(ctx context.Context, bucketName, objectName string, reader io.Reader, objectSize int64, + opts AppendObjectOptions, +) (info UploadInfo, err error) { + if objectSize < 0 && opts.ChunkSize == 0 { + return UploadInfo{}, errors.New("object size must be provided when no chunk size is provided") + } + + if err = opts.validate(c); err != nil { + return UploadInfo{}, err + } + + oinfo, err := c.StatObject(ctx, bucketName, objectName, StatObjectOptions{Checksum: true}) + if err != nil { + return UploadInfo{}, err + } + if oinfo.ChecksumMode != ChecksumFullObjectMode.String() { + return UploadInfo{}, fmt.Errorf("append API is not allowed on objects that are not full_object checksum type: %s", oinfo.ChecksumMode) + } + opts.setChecksumParams(oinfo) // set the appropriate checksum params based on the existing object checksum metadata. + opts.setWriteOffset(oinfo.Size) // First append must set the current object size as the offset. + + if opts.ChunkSize > 0 { + finalObjSize := int64(-1) + if objectSize > 0 { + finalObjSize = info.Size + objectSize + } + totalPartsCount, partSize, lastPartSize, err := OptimalPartInfo(finalObjSize, opts.ChunkSize) + if err != nil { + return UploadInfo{}, err + } + buf := make([]byte, partSize) + var partNumber int + for partNumber = 1; partNumber <= totalPartsCount; partNumber++ { + // Proceed to upload the part. + if partNumber == totalPartsCount { + partSize = lastPartSize + } + n, err := readFull(reader, buf) + if err != nil { + return info, err + } + if n != int(partSize) { + return info, io.ErrUnexpectedEOF + } + rd := newHook(bytes.NewReader(buf[:n]), opts.Progress) + uinfo, err := c.appendObjectDo(ctx, bucketName, objectName, rd, partSize, opts) + if err != nil { + return info, err + } + opts.setWriteOffset(uinfo.Size) + } + } + + rd := newHook(reader, opts.Progress) + return c.appendObjectDo(ctx, bucketName, objectName, rd, objectSize, opts) +} diff --git a/vendor/github.com/minio/minio-go/v7/api-bucket-notification.go b/vendor/github.com/minio/minio-go/v7/api-bucket-notification.go index ad8eada4a88..b1e5b0aae66 100644 --- a/vendor/github.com/minio/minio-go/v7/api-bucket-notification.go +++ b/vendor/github.com/minio/minio-go/v7/api-bucket-notification.go @@ -157,13 +157,6 @@ func (c *Client) ListenBucketNotification(ctx context.Context, bucketName, prefi return } - // Continuously run and listen on bucket notification. - // Create a done channel to control 'ListObjects' go routine. - retryDoneCh := make(chan struct{}, 1) - - // Indicate to our routine to exit cleanly upon return. - defer close(retryDoneCh) - // Prepare urlValues to pass into the request on every loop urlValues := make(url.Values) urlValues.Set("ping", "10") @@ -172,7 +165,7 @@ func (c *Client) ListenBucketNotification(ctx context.Context, bucketName, prefi urlValues["events"] = events // Wait on the jitter retry loop. - for range c.newRetryTimerContinous(time.Second, time.Second*30, MaxJitter, retryDoneCh) { + for range c.newRetryTimerContinous(time.Second, time.Second*30, MaxJitter) { // Execute GET on bucket to list objects. resp, err := c.executeMethod(ctx, http.MethodGet, requestMetadata{ bucketName: bucketName, @@ -251,7 +244,6 @@ func (c *Client) ListenBucketNotification(ctx context.Context, bucketName, prefi // Close current connection before looping further. closeResponse(resp) - } }(notificationInfoCh) diff --git a/vendor/github.com/minio/minio-go/v7/api-bucket-versioning.go b/vendor/github.com/minio/minio-go/v7/api-bucket-versioning.go index 8c84e4f27b1..045e3c38ec6 100644 --- a/vendor/github.com/minio/minio-go/v7/api-bucket-versioning.go +++ b/vendor/github.com/minio/minio-go/v7/api-bucket-versioning.go @@ -90,6 +90,7 @@ type BucketVersioningConfiguration struct { // Requires versioning to be enabled ExcludedPrefixes []ExcludedPrefix `xml:",omitempty"` ExcludeFolders bool `xml:",omitempty"` + PurgeOnDelete string `xml:",omitempty"` } // Various supported states diff --git a/vendor/github.com/minio/minio-go/v7/api-compose-object.go b/vendor/github.com/minio/minio-go/v7/api-compose-object.go index bb595626e6a..2574c135a76 100644 --- a/vendor/github.com/minio/minio-go/v7/api-compose-object.go +++ b/vendor/github.com/minio/minio-go/v7/api-compose-object.go @@ -30,6 +30,7 @@ import ( "github.com/google/uuid" "github.com/minio/minio-go/v7/pkg/encrypt" "github.com/minio/minio-go/v7/pkg/s3utils" + "github.com/minio/minio-go/v7/pkg/tags" ) // CopyDestOptions represents options specified by user for CopyObject/ComposeObject APIs @@ -98,8 +99,8 @@ func (opts CopyDestOptions) Marshal(header http.Header) { const replaceDirective = "REPLACE" if opts.ReplaceTags { header.Set(amzTaggingHeaderDirective, replaceDirective) - if tags := s3utils.TagEncode(opts.UserTags); tags != "" { - header.Set(amzTaggingHeader, tags) + if tags, _ := tags.NewTags(opts.UserTags, true); tags != nil { + header.Set(amzTaggingHeader, tags.String()) } } @@ -236,7 +237,9 @@ func (c *Client) copyObjectDo(ctx context.Context, srcBucket, srcObject, destBuc } if len(dstOpts.UserTags) != 0 { - headers.Set(amzTaggingHeader, s3utils.TagEncode(dstOpts.UserTags)) + if tags, _ := tags.NewTags(dstOpts.UserTags, true); tags != nil { + headers.Set(amzTaggingHeader, tags.String()) + } } reqMetadata := requestMetadata{ diff --git a/vendor/github.com/minio/minio-go/v7/api-copy-object.go b/vendor/github.com/minio/minio-go/v7/api-copy-object.go index 0c95d91ec76..b6cadc86a92 100644 --- a/vendor/github.com/minio/minio-go/v7/api-copy-object.go +++ b/vendor/github.com/minio/minio-go/v7/api-copy-object.go @@ -68,7 +68,7 @@ func (c *Client) CopyObject(ctx context.Context, dst CopyDestOptions, src CopySr Bucket: dst.Bucket, Key: dst.Object, LastModified: cpObjRes.LastModified, - ETag: trimEtag(resp.Header.Get("ETag")), + ETag: trimEtag(cpObjRes.ETag), VersionID: resp.Header.Get(amzVersionID), Expiration: expTime, ExpirationRuleID: ruleID, diff --git a/vendor/github.com/minio/minio-go/v7/api-datatypes.go b/vendor/github.com/minio/minio-go/v7/api-datatypes.go index 8a8fd889856..39ff9d27c16 100644 --- a/vendor/github.com/minio/minio-go/v7/api-datatypes.go +++ b/vendor/github.com/minio/minio-go/v7/api-datatypes.go @@ -148,6 +148,7 @@ type UploadInfo struct { ChecksumSHA1 string ChecksumSHA256 string ChecksumCRC64NVME string + ChecksumMode string } // RestoreInfo contains information of the restore operation of an archived object @@ -212,6 +213,8 @@ type ObjectInfo struct { // not to be confused with `Expires` HTTP header. Expiration time.Time ExpirationRuleID string + // NumVersions is the number of versions of the object. + NumVersions int Restore *RestoreInfo @@ -221,6 +224,7 @@ type ObjectInfo struct { ChecksumSHA1 string ChecksumSHA256 string ChecksumCRC64NVME string + ChecksumMode string Internal *struct { K int // Data blocks diff --git a/vendor/github.com/minio/minio-go/v7/api-get-object-acl.go b/vendor/github.com/minio/minio-go/v7/api-get-object-acl.go index 9041d99e937..5864f0260d0 100644 --- a/vendor/github.com/minio/minio-go/v7/api-get-object-acl.go +++ b/vendor/github.com/minio/minio-go/v7/api-get-object-acl.go @@ -135,16 +135,16 @@ func getAmzGrantACL(aCPolicy *accessControlPolicy) map[string][]string { res := map[string][]string{} for _, g := range grants { - switch { - case g.Permission == "READ": + switch g.Permission { + case "READ": res["X-Amz-Grant-Read"] = append(res["X-Amz-Grant-Read"], "id="+g.Grantee.ID) - case g.Permission == "WRITE": + case "WRITE": res["X-Amz-Grant-Write"] = append(res["X-Amz-Grant-Write"], "id="+g.Grantee.ID) - case g.Permission == "READ_ACP": + case "READ_ACP": res["X-Amz-Grant-Read-Acp"] = append(res["X-Amz-Grant-Read-Acp"], "id="+g.Grantee.ID) - case g.Permission == "WRITE_ACP": + case "WRITE_ACP": res["X-Amz-Grant-Write-Acp"] = append(res["X-Amz-Grant-Write-Acp"], "id="+g.Grantee.ID) - case g.Permission == "FULL_CONTROL": + case "FULL_CONTROL": res["X-Amz-Grant-Full-Control"] = append(res["X-Amz-Grant-Full-Control"], "id="+g.Grantee.ID) } } diff --git a/vendor/github.com/minio/minio-go/v7/api-list.go b/vendor/github.com/minio/minio-go/v7/api-list.go index 31b6edf2ef4..26d35c4c2a2 100644 --- a/vendor/github.com/minio/minio-go/v7/api-list.go +++ b/vendor/github.com/minio/minio-go/v7/api-list.go @@ -22,6 +22,7 @@ import ( "fmt" "net/http" "net/url" + "slices" "time" "github.com/minio/minio-go/v7/pkg/s3utils" @@ -421,20 +422,17 @@ func (c *Client) listObjectVersions(ctx context.Context, bucketName string, opts var ( keyMarker = "" versionIDMarker = "" + preName = "" + preKey = "" + perVersions []Version + numVersions int ) - - for { - // Get list of objects a maximum of 1000 per request. - result, err := c.listObjectVersionsQuery(ctx, bucketName, opts, keyMarker, versionIDMarker, delimiter) - if err != nil { - sendObjectInfo(ObjectInfo{ - Err: err, - }) - return + send := func(vers []Version) { + if opts.WithVersions && opts.ReverseVersions { + slices.Reverse(vers) + numVersions = len(vers) } - - // If contents are available loop through and send over channel. - for _, version := range result.Versions { + for _, version := range vers { info := ObjectInfo{ ETag: trimEtag(version.ETag), Key: version.Key, @@ -448,6 +446,7 @@ func (c *Client) listObjectVersions(ctx context.Context, bucketName string, opts UserTags: version.UserTags, UserMetadata: version.UserMetadata, Internal: version.Internal, + NumVersions: numVersions, } select { // Send object version info. @@ -457,6 +456,38 @@ func (c *Client) listObjectVersions(ctx context.Context, bucketName string, opts return } } + } + for { + // Get list of objects a maximum of 1000 per request. + result, err := c.listObjectVersionsQuery(ctx, bucketName, opts, keyMarker, versionIDMarker, delimiter) + if err != nil { + sendObjectInfo(ObjectInfo{ + Err: err, + }) + return + } + if opts.WithVersions && opts.ReverseVersions { + for _, version := range result.Versions { + if preName == "" { + preName = result.Name + preKey = version.Key + } + if result.Name == preName && preKey == version.Key { + // If the current name is same as previous name, + // we need to append the version to the previous version. + perVersions = append(perVersions, version) + continue + } + // Send the file versions. + send(perVersions) + perVersions = perVersions[:0] + perVersions = append(perVersions, version) + preName = result.Name + preKey = version.Key + } + } else { + send(result.Versions) + } // Send all common prefixes if any. // NOTE: prefixes are only present if the request is delimited. @@ -480,8 +511,17 @@ func (c *Client) listObjectVersions(ctx context.Context, bucketName string, opts versionIDMarker = result.NextVersionIDMarker } + // If context is canceled, return here. + if contextCanceled(ctx) { + return + } + // Listing ends result is not truncated, return right here. if !result.IsTruncated { + // sent the lasted file with versions + if opts.ReverseVersions && len(perVersions) > 0 { + send(perVersions) + } return } } @@ -683,6 +723,8 @@ func (c *Client) listObjectsQuery(ctx context.Context, bucketName, objectPrefix, // ListObjectsOptions holds all options of a list object request type ListObjectsOptions struct { + // ReverseVersions - reverse the order of the object versions + ReverseVersions bool // Include objects versions in the listing WithVersions bool // Include objects metadata in the listing diff --git a/vendor/github.com/minio/minio-go/v7/api-presigned.go b/vendor/github.com/minio/minio-go/v7/api-presigned.go index 9e85f818167..29642200ee1 100644 --- a/vendor/github.com/minio/minio-go/v7/api-presigned.go +++ b/vendor/github.com/minio/minio-go/v7/api-presigned.go @@ -140,7 +140,7 @@ func (c *Client) PresignedPostPolicy(ctx context.Context, p *PostPolicy) (u *url } // Get credentials from the configured credentials provider. - credValues, err := c.credsProvider.Get() + credValues, err := c.credsProvider.GetWithContext(c.CredContext()) if err != nil { return nil, nil, err } diff --git a/vendor/github.com/minio/minio-go/v7/api-put-object-multipart.go b/vendor/github.com/minio/minio-go/v7/api-put-object-multipart.go index 03bd34f76ba..84bc19b28f9 100644 --- a/vendor/github.com/minio/minio-go/v7/api-put-object-multipart.go +++ b/vendor/github.com/minio/minio-go/v7/api-put-object-multipart.go @@ -457,5 +457,6 @@ func (c *Client) completeMultipartUpload(ctx context.Context, bucketName, object ChecksumCRC32: completeMultipartUploadResult.ChecksumCRC32, ChecksumCRC32C: completeMultipartUploadResult.ChecksumCRC32C, ChecksumCRC64NVME: completeMultipartUploadResult.ChecksumCRC64NVME, + ChecksumMode: completeMultipartUploadResult.ChecksumType, }, nil } diff --git a/vendor/github.com/minio/minio-go/v7/api-put-object-streaming.go b/vendor/github.com/minio/minio-go/v7/api-put-object-streaming.go index 3ff3b69efd6..987a3c69280 100644 --- a/vendor/github.com/minio/minio-go/v7/api-put-object-streaming.go +++ b/vendor/github.com/minio/minio-go/v7/api-put-object-streaming.go @@ -350,7 +350,6 @@ func (c *Client) putObjectMultipartStreamOptionalChecksum(ctx context.Context, b // Part number always starts with '1'. var partNumber int for partNumber = 1; partNumber <= totalPartsCount; partNumber++ { - // Proceed to upload the part. if partNumber == totalPartsCount { partSize = lastPartSize @@ -806,5 +805,6 @@ func (c *Client) putObjectDo(ctx context.Context, bucketName, objectName string, ChecksumSHA1: h.Get(ChecksumSHA1.Key()), ChecksumSHA256: h.Get(ChecksumSHA256.Key()), ChecksumCRC64NVME: h.Get(ChecksumCRC64NVME.Key()), + ChecksumMode: h.Get(ChecksumFullObjectMode.Key()), }, nil } diff --git a/vendor/github.com/minio/minio-go/v7/api-put-object.go b/vendor/github.com/minio/minio-go/v7/api-put-object.go index 09817578412..ce483479039 100644 --- a/vendor/github.com/minio/minio-go/v7/api-put-object.go +++ b/vendor/github.com/minio/minio-go/v7/api-put-object.go @@ -30,6 +30,7 @@ import ( "github.com/minio/minio-go/v7/pkg/encrypt" "github.com/minio/minio-go/v7/pkg/s3utils" + "github.com/minio/minio-go/v7/pkg/tags" "golang.org/x/net/http/httpguts" ) @@ -229,7 +230,9 @@ func (opts PutObjectOptions) Header() (header http.Header) { } if len(opts.UserTags) != 0 { - header.Set(amzTaggingHeader, s3utils.TagEncode(opts.UserTags)) + if tags, _ := tags.NewTags(opts.UserTags, true); tags != nil { + header.Set(amzTaggingHeader, tags.String()) + } } for k, v := range opts.UserMetadata { diff --git a/vendor/github.com/minio/minio-go/v7/api-remove.go b/vendor/github.com/minio/minio-go/v7/api-remove.go index d2e932923f1..5b4443ec579 100644 --- a/vendor/github.com/minio/minio-go/v7/api-remove.go +++ b/vendor/github.com/minio/minio-go/v7/api-remove.go @@ -213,6 +213,14 @@ type RemoveObjectError struct { Err error } +func (err *RemoveObjectError) Error() string { + // This should never happen as we will have a non-nil error with no underlying error. + if err.Err == nil { + return "unexpected remove object error result" + } + return err.Err.Error() +} + // RemoveObjectResult - container of Multi Delete S3 API result type RemoveObjectResult struct { ObjectName string @@ -384,10 +392,7 @@ func (c *Client) removeObjects(ctx context.Context, bucketName string, objectsCh defer close(resultCh) // Loop over entries by 1000 and call MultiDelete requests - for { - if finish { - break - } + for !finish { count := 0 var batch []ObjectInfo diff --git a/vendor/github.com/minio/minio-go/v7/api-s3-datatypes.go b/vendor/github.com/minio/minio-go/v7/api-s3-datatypes.go index 5e015fb8279..3204263dc72 100644 --- a/vendor/github.com/minio/minio-go/v7/api-s3-datatypes.go +++ b/vendor/github.com/minio/minio-go/v7/api-s3-datatypes.go @@ -194,7 +194,6 @@ func (l *ListVersionsResult) UnmarshalXML(d *xml.Decoder, _ xml.StartElement) (e default: return errors.New("unrecognized option:" + tagName) } - } } return nil @@ -367,6 +366,7 @@ type completeMultipartUploadResult struct { ChecksumSHA1 string ChecksumSHA256 string ChecksumCRC64NVME string + ChecksumType string } // CompletePart sub container lists individual part numbers and their diff --git a/vendor/github.com/minio/minio-go/v7/api-select.go b/vendor/github.com/minio/minio-go/v7/api-select.go index 628d967ff46..4fb4db9ba31 100644 --- a/vendor/github.com/minio/minio-go/v7/api-select.go +++ b/vendor/github.com/minio/minio-go/v7/api-select.go @@ -609,7 +609,6 @@ func (s *SelectResults) start(pipeWriter *io.PipeWriter) { closeResponse(s.resp) return } - } }() } @@ -669,7 +668,6 @@ func extractHeader(body io.Reader, myHeaders http.Header) error { } myHeaders.Set(headerTypeName, headerValueName) - } return nil } diff --git a/vendor/github.com/minio/minio-go/v7/api.go b/vendor/github.com/minio/minio-go/v7/api.go index 83c003e499f..1e457d807d5 100644 --- a/vendor/github.com/minio/minio-go/v7/api.go +++ b/vendor/github.com/minio/minio-go/v7/api.go @@ -92,6 +92,9 @@ type Client struct { // default to Auto. lookup BucketLookupType + // lookupFn is a custom function to return URL lookup type supported by the server. + lookupFn func(u url.URL, bucketName string) BucketLookupType + // Factory for MD5 hash functions. md5Hasher func() md5simd.Hasher sha256Hasher func() md5simd.Hasher @@ -117,6 +120,25 @@ type Options struct { // function to perform region lookups appropriately. CustomRegionViaURL func(u url.URL) string + // Provide a custom function that returns BucketLookupType based + // on the input URL, this is just like s3utils.IsVirtualHostSupported() + // function but allows users to provide their own implementation. + // Once this is set it overrides all settings for opts.BucketLookup + // if this function returns BucketLookupAuto then default detection + // via s3utils.IsVirtualHostSupported() is used, otherwise the + // function is expected to return appropriate value as expected for + // the URL the user wishes to honor. + // + // BucketName is passed additionally for the caller to ensure + // handle situations where `bucketNames` have multiple `.` separators + // in such case HTTPs certs will not work properly for *. + // wildcards, so you need to specifically handle these situations + // and not return bucket as part of DNS since those requests may fail. + // + // For better understanding look at s3utils.IsVirtualHostSupported() + // implementation. + BucketLookupViaURL func(u url.URL, bucketName string) BucketLookupType + // TrailingHeaders indicates server support of trailing headers. // Only supported for v4 signatures. TrailingHeaders bool @@ -133,7 +155,7 @@ type Options struct { // Global constants. const ( libraryName = "minio-go" - libraryVersion = "v7.0.82" + libraryVersion = "v7.0.90" ) // User Agent should always following the below style. @@ -279,6 +301,7 @@ func privateNew(endpoint string, opts *Options) (*Client, error) { // Sets bucket lookup style, whether server accepts DNS or Path lookup. Default is Auto - determined // by the SDK. When Auto is specified, DNS lookup is used for Amazon/Google cloud endpoints and Path for all other endpoints. clnt.lookup = opts.BucketLookup + clnt.lookupFn = opts.BucketLookupViaURL // healthcheck is not initialized clnt.healthStatus = unknown @@ -575,7 +598,7 @@ func (c *Client) do(req *http.Request) (resp *http.Response, err error) { // If trace is enabled, dump http request and response, // except when the traceErrorsOnly enabled and the response's status code is ok - if c.isTraceEnabled && !(c.traceErrorsOnly && resp.StatusCode == http.StatusOK) { + if c.isTraceEnabled && (!c.traceErrorsOnly || resp.StatusCode != http.StatusOK) { err = c.dumpHTTP(req, resp) if err != nil { return nil, err @@ -600,9 +623,9 @@ func (c *Client) executeMethod(ctx context.Context, method string, metadata requ return nil, errors.New(c.endpointURL.String() + " is offline.") } - var retryable bool // Indicates if request can be retried. - var bodySeeker io.Seeker // Extracted seeker from io.Reader. - var reqRetry = c.maxRetries // Indicates how many times we can retry the request + var retryable bool // Indicates if request can be retried. + var bodySeeker io.Seeker // Extracted seeker from io.Reader. + reqRetry := c.maxRetries // Indicates how many times we can retry the request if metadata.contentBody != nil { // Check if body is seekable then it is retryable. @@ -637,13 +660,7 @@ func (c *Client) executeMethod(ctx context.Context, method string, metadata requ metadata.trailer.Set(metadata.addCrc.Key(), base64.StdEncoding.EncodeToString(crc.Sum(nil))) } - // Create cancel context to control 'newRetryTimer' go routine. - retryCtx, cancel := context.WithCancel(ctx) - - // Indicate to our routine to exit cleanly upon return. - defer cancel() - - for range c.newRetryTimer(retryCtx, reqRetry, DefaultRetryUnit, DefaultRetryCap, MaxJitter) { + for range c.newRetryTimer(ctx, reqRetry, DefaultRetryUnit, DefaultRetryCap, MaxJitter) { // Retry executes the following function body if request has an // error until maxRetries have been exhausted, retry attempts are // performed after waiting for a given period of time in a @@ -756,7 +773,7 @@ func (c *Client) executeMethod(ctx context.Context, method string, metadata requ } // Return an error when retry is canceled or deadlined - if e := retryCtx.Err(); e != nil { + if e := ctx.Err(); e != nil { return nil, e } @@ -808,7 +825,7 @@ func (c *Client) newRequest(ctx context.Context, method string, metadata request } // Get credentials from the configured credentials provider. - value, err := c.credsProvider.Get() + value, err := c.credsProvider.GetWithContext(c.CredContext()) if err != nil { return nil, err } @@ -886,6 +903,11 @@ func (c *Client) newRequest(ctx context.Context, method string, metadata request // For anonymous requests just return. if signerType.IsAnonymous() { + if len(metadata.trailer) > 0 { + req.Header.Set("X-Amz-Content-Sha256", unsignedPayloadTrailer) + return signer.UnsignedTrailer(*req, metadata.trailer), nil + } + return req, nil } @@ -1003,6 +1025,18 @@ func (c *Client) makeTargetURL(bucketName, objectName, bucketLocation string, is // returns true if virtual hosted style requests are to be used. func (c *Client) isVirtualHostStyleRequest(url url.URL, bucketName string) bool { + if c.lookupFn != nil { + lookup := c.lookupFn(url, bucketName) + switch lookup { + case BucketLookupDNS: + return true + case BucketLookupPath: + return false + } + // if its auto then we fallback to default detection. + return s3utils.IsVirtualHostSupported(url, bucketName) + } + if bucketName == "" { return false } @@ -1010,11 +1044,32 @@ func (c *Client) isVirtualHostStyleRequest(url url.URL, bucketName string) bool if c.lookup == BucketLookupDNS { return true } + if c.lookup == BucketLookupPath { return false } - // default to virtual only for Amazon/Google storage. In all other cases use + // default to virtual only for Amazon/Google storage. In all other cases use // path style requests return s3utils.IsVirtualHostSupported(url, bucketName) } + +// CredContext returns the context for fetching credentials +func (c *Client) CredContext() *credentials.CredContext { + httpClient := c.httpClient + if httpClient == nil { + httpClient = http.DefaultClient + } + return &credentials.CredContext{ + Client: httpClient, + Endpoint: c.endpointURL.String(), + } +} + +// GetCreds returns the access creds for the client +func (c *Client) GetCreds() (credentials.Value, error) { + if c.credsProvider == nil { + return credentials.Value{}, errors.New("no credentials provider") + } + return c.credsProvider.GetWithContext(c.CredContext()) +} diff --git a/vendor/github.com/minio/minio-go/v7/bucket-cache.go b/vendor/github.com/minio/minio-go/v7/bucket-cache.go index b1d3b3852cf..4e4305acd5b 100644 --- a/vendor/github.com/minio/minio-go/v7/bucket-cache.go +++ b/vendor/github.com/minio/minio-go/v7/bucket-cache.go @@ -212,7 +212,7 @@ func (c *Client) getBucketLocationRequest(ctx context.Context, bucketName string c.setUserAgent(req) // Get credentials from the configured credentials provider. - value, err := c.credsProvider.Get() + value, err := c.credsProvider.GetWithContext(c.CredContext()) if err != nil { return nil, err } diff --git a/vendor/github.com/minio/minio-go/v7/checksum.go b/vendor/github.com/minio/minio-go/v7/checksum.go index 8e4c27ce42f..5c24bf64a59 100644 --- a/vendor/github.com/minio/minio-go/v7/checksum.go +++ b/vendor/github.com/minio/minio-go/v7/checksum.go @@ -30,8 +30,47 @@ import ( "math/bits" "net/http" "sort" + + "github.com/minio/crc64nvme" ) +// ChecksumMode contains information about the checksum mode on the object +type ChecksumMode uint32 + +const ( + // ChecksumFullObjectMode Full object checksum `csumCombine(csum1, csum2...)...), csumN...)` + ChecksumFullObjectMode ChecksumMode = 1 << iota + + // ChecksumCompositeMode Composite checksum `csum([csum1 + csum2 ... + csumN])` + ChecksumCompositeMode + + // Keep after all valid checksums + checksumLastMode + + // checksumModeMask is a mask for valid checksum mode types. + checksumModeMask = checksumLastMode - 1 +) + +// Is returns if c is all of t. +func (c ChecksumMode) Is(t ChecksumMode) bool { + return c&t == t +} + +// Key returns the header key. +func (c ChecksumMode) Key() string { + return amzChecksumMode +} + +func (c ChecksumMode) String() string { + switch c & checksumModeMask { + case ChecksumFullObjectMode: + return "FULL_OBJECT" + case ChecksumCompositeMode: + return "COMPOSITE" + } + return "" +} + // ChecksumType contains information about the checksum type. type ChecksumType uint32 @@ -73,6 +112,7 @@ const ( amzChecksumSHA1 = "x-amz-checksum-sha1" amzChecksumSHA256 = "x-amz-checksum-sha256" amzChecksumCRC64NVME = "x-amz-checksum-crc64nvme" + amzChecksumMode = "x-amz-checksum-type" ) // Base returns the base type, without modifiers. @@ -152,9 +192,6 @@ func (c ChecksumType) RawByteLen() int { const crc64NVMEPolynomial = 0xad93d23594c93659 -// crc64 uses reversed polynomials. -var crc64Table = crc64.MakeTable(bits.Reverse64(crc64NVMEPolynomial)) - // Hasher returns a hasher corresponding to the checksum type. // Returns nil if no checksum. func (c ChecksumType) Hasher() hash.Hash { @@ -168,7 +205,7 @@ func (c ChecksumType) Hasher() hash.Hash { case ChecksumSHA256: return sha256.New() case ChecksumCRC64NVME: - return crc64.New(crc64Table) + return crc64nvme.New() } return nil } @@ -398,7 +435,7 @@ func addAutoChecksumHeaders(opts *PutObjectOptions) { } opts.UserMetadata["X-Amz-Checksum-Algorithm"] = opts.AutoChecksum.String() if opts.AutoChecksum.FullObjectRequested() { - opts.UserMetadata["X-Amz-Checksum-Type"] = "FULL_OBJECT" + opts.UserMetadata[amzChecksumMode] = ChecksumFullObjectMode.String() } } @@ -415,7 +452,10 @@ func applyAutoChecksum(opts *PutObjectOptions, allParts []ObjectPart) { } else if opts.AutoChecksum.CanMergeCRC() { crc, err := opts.AutoChecksum.FullObjectChecksum(allParts) if err == nil { - opts.UserMetadata = map[string]string{opts.AutoChecksum.KeyCapitalized(): crc.Encoded(), "X-Amz-Checksum-Type": "FULL_OBJECT"} + opts.UserMetadata = map[string]string{ + opts.AutoChecksum.KeyCapitalized(): crc.Encoded(), + amzChecksumMode: ChecksumFullObjectMode.String(), + } } } } diff --git a/vendor/github.com/minio/minio-go/v7/hook-reader.go b/vendor/github.com/minio/minio-go/v7/hook-reader.go index 07bc7dbcfc8..61268a1045d 100644 --- a/vendor/github.com/minio/minio-go/v7/hook-reader.go +++ b/vendor/github.com/minio/minio-go/v7/hook-reader.go @@ -20,7 +20,6 @@ package minio import ( "fmt" "io" - "sync" ) // hookReader hooks additional reader in the source stream. It is @@ -28,7 +27,6 @@ import ( // notified about the exact number of bytes read from the primary // source on each Read operation. type hookReader struct { - mu sync.RWMutex source io.Reader hook io.Reader } @@ -36,9 +34,6 @@ type hookReader struct { // Seek implements io.Seeker. Seeks source first, and if necessary // seeks hook if Seek method is appropriately found. func (hr *hookReader) Seek(offset int64, whence int) (n int64, err error) { - hr.mu.Lock() - defer hr.mu.Unlock() - // Verify for source has embedded Seeker, use it. sourceSeeker, ok := hr.source.(io.Seeker) if ok { @@ -70,9 +65,6 @@ func (hr *hookReader) Seek(offset int64, whence int) (n int64, err error) { // value 'n' number of bytes are reported through the hook. Returns // error for all non io.EOF conditions. func (hr *hookReader) Read(b []byte) (n int, err error) { - hr.mu.RLock() - defer hr.mu.RUnlock() - n, err = hr.source.Read(b) if err != nil && err != io.EOF { return n, err @@ -92,7 +84,7 @@ func (hr *hookReader) Read(b []byte) (n int, err error) { // reports the data read from the source to the hook. func newHook(source, hook io.Reader) io.Reader { if hook == nil { - return &hookReader{source: source} + return source } return &hookReader{ source: source, diff --git a/vendor/github.com/minio/minio-go/v7/pkg/credentials/assume_role.go b/vendor/github.com/minio/minio-go/v7/pkg/credentials/assume_role.go index d245bc07a3a..415b0709520 100644 --- a/vendor/github.com/minio/minio-go/v7/pkg/credentials/assume_role.go +++ b/vendor/github.com/minio/minio-go/v7/pkg/credentials/assume_role.go @@ -76,7 +76,8 @@ type AssumeRoleResult struct { type STSAssumeRole struct { Expiry - // Required http Client to use when connecting to MinIO STS service. + // Optional http Client to use when connecting to MinIO STS service + // (overrides default client in CredContext) Client *http.Client // STS endpoint to fetch STS credentials. @@ -103,21 +104,17 @@ type STSAssumeRoleOptions struct { RoleARN string RoleSessionName string ExternalID string + + TokenRevokeType string // Optional, used for token revokation (MinIO only extension) } // NewSTSAssumeRole returns a pointer to a new // Credentials object wrapping the STSAssumeRole. func NewSTSAssumeRole(stsEndpoint string, opts STSAssumeRoleOptions) (*Credentials, error) { - if stsEndpoint == "" { - return nil, errors.New("STS endpoint cannot be empty") - } if opts.AccessKey == "" || opts.SecretKey == "" { return nil, errors.New("AssumeRole credentials access/secretkey is mandatory") } return New(&STSAssumeRole{ - Client: &http.Client{ - Transport: http.DefaultTransport, - }, STSEndpoint: stsEndpoint, Options: opts, }), nil @@ -166,6 +163,9 @@ func getAssumeRoleCredentials(clnt *http.Client, endpoint string, opts STSAssume if opts.ExternalID != "" { v.Set("ExternalId", opts.ExternalID) } + if opts.TokenRevokeType != "" { + v.Set("TokenRevokeType", opts.TokenRevokeType) + } u, err := url.Parse(endpoint) if err != nil { @@ -222,10 +222,30 @@ func getAssumeRoleCredentials(clnt *http.Client, endpoint string, opts STSAssume return a, nil } -// Retrieve retrieves credentials from the MinIO service. -// Error will be returned if the request fails. -func (m *STSAssumeRole) Retrieve() (Value, error) { - a, err := getAssumeRoleCredentials(m.Client, m.STSEndpoint, m.Options) +// RetrieveWithCredContext retrieves credentials from the MinIO service. +// Error will be returned if the request fails, optional cred context. +func (m *STSAssumeRole) RetrieveWithCredContext(cc *CredContext) (Value, error) { + if cc == nil { + cc = defaultCredContext + } + + client := m.Client + if client == nil { + client = cc.Client + } + if client == nil { + client = defaultCredContext.Client + } + + stsEndpoint := m.STSEndpoint + if stsEndpoint == "" { + stsEndpoint = cc.Endpoint + } + if stsEndpoint == "" { + return Value{}, errors.New("STS endpoint unknown") + } + + a, err := getAssumeRoleCredentials(client, stsEndpoint, m.Options) if err != nil { return Value{}, err } @@ -241,3 +261,9 @@ func (m *STSAssumeRole) Retrieve() (Value, error) { SignerType: SignatureV4, }, nil } + +// Retrieve retrieves credentials from the MinIO service. +// Error will be returned if the request fails. +func (m *STSAssumeRole) Retrieve() (Value, error) { + return m.RetrieveWithCredContext(nil) +} diff --git a/vendor/github.com/minio/minio-go/v7/pkg/credentials/chain.go b/vendor/github.com/minio/minio-go/v7/pkg/credentials/chain.go index ddccfb173fe..5ef3597d104 100644 --- a/vendor/github.com/minio/minio-go/v7/pkg/credentials/chain.go +++ b/vendor/github.com/minio/minio-go/v7/pkg/credentials/chain.go @@ -55,6 +55,24 @@ func NewChainCredentials(providers []Provider) *Credentials { }) } +// RetrieveWithCredContext is like Retrieve with CredContext +func (c *Chain) RetrieveWithCredContext(cc *CredContext) (Value, error) { + for _, p := range c.Providers { + creds, _ := p.RetrieveWithCredContext(cc) + // Always prioritize non-anonymous providers, if any. + if creds.AccessKeyID == "" && creds.SecretAccessKey == "" { + continue + } + c.curr = p + return creds, nil + } + // At this point we have exhausted all the providers and + // are left without any credentials return anonymous. + return Value{ + SignerType: SignatureAnonymous, + }, nil +} + // Retrieve returns the credentials value, returns no credentials(anonymous) // if no credentials provider returned any value. // diff --git a/vendor/github.com/minio/minio-go/v7/pkg/credentials/credentials.go b/vendor/github.com/minio/minio-go/v7/pkg/credentials/credentials.go index 68f9b38157e..52aff9a57f6 100644 --- a/vendor/github.com/minio/minio-go/v7/pkg/credentials/credentials.go +++ b/vendor/github.com/minio/minio-go/v7/pkg/credentials/credentials.go @@ -18,6 +18,7 @@ package credentials import ( + "net/http" "sync" "time" ) @@ -30,6 +31,10 @@ const ( defaultExpiryWindow = 0.8 ) +// defaultCredContext is used when the credential context doesn't +// actually matter or the default context is suitable. +var defaultCredContext = &CredContext{Client: http.DefaultClient} + // A Value is the S3 credentials value for individual credential fields. type Value struct { // S3 Access key ID @@ -52,8 +57,17 @@ type Value struct { // Value. A provider is required to manage its own Expired state, and what to // be expired means. type Provider interface { + // RetrieveWithCredContext returns nil if it successfully retrieved the + // value. Error is returned if the value were not obtainable, or empty. + // optionally takes CredContext for additional context to retrieve credentials. + RetrieveWithCredContext(cc *CredContext) (Value, error) + // Retrieve returns nil if it successfully retrieved the value. // Error is returned if the value were not obtainable, or empty. + // + // Deprecated: Retrieve() exists for historical compatibility and should not + // be used. To get new credentials use the RetrieveWithCredContext function + // to ensure the proper context (i.e. HTTP client) will be used. Retrieve() (Value, error) // IsExpired returns if the credentials are no longer valid, and need @@ -61,6 +75,18 @@ type Provider interface { IsExpired() bool } +// CredContext is passed to the Retrieve function of a provider to provide +// some additional context to retrieve credentials. +type CredContext struct { + // Client specifies the HTTP client that should be used if an HTTP + // request is to be made to fetch the credentials. + Client *http.Client + + // Endpoint specifies the MinIO endpoint that will be used if no + // explicit endpoint is provided. + Endpoint string +} + // A Expiry provides shared expiration logic to be used by credentials // providers to implement expiry functionality. // @@ -146,16 +172,36 @@ func New(provider Provider) *Credentials { // // If Credentials.Expire() was called the credentials Value will be force // expired, and the next call to Get() will cause them to be refreshed. +// +// Deprecated: Get() exists for historical compatibility and should not be +// used. To get new credentials use the Credentials.GetWithContext function +// to ensure the proper context (i.e. HTTP client) will be used. func (c *Credentials) Get() (Value, error) { + return c.GetWithContext(nil) +} + +// GetWithContext returns the credentials value, or error if the +// credentials Value failed to be retrieved. +// +// Will return the cached credentials Value if it has not expired. If the +// credentials Value has expired the Provider's Retrieve() will be called +// to refresh the credentials. +// +// If Credentials.Expire() was called the credentials Value will be force +// expired, and the next call to Get() will cause them to be refreshed. +func (c *Credentials) GetWithContext(cc *CredContext) (Value, error) { if c == nil { return Value{}, nil } + if cc == nil { + cc = defaultCredContext + } c.Lock() defer c.Unlock() if c.isExpired() { - creds, err := c.provider.Retrieve() + creds, err := c.provider.RetrieveWithCredContext(cc) if err != nil { return Value{}, err } diff --git a/vendor/github.com/minio/minio-go/v7/pkg/credentials/env_aws.go b/vendor/github.com/minio/minio-go/v7/pkg/credentials/env_aws.go index b6e60d0e165..21ab0a38a4d 100644 --- a/vendor/github.com/minio/minio-go/v7/pkg/credentials/env_aws.go +++ b/vendor/github.com/minio/minio-go/v7/pkg/credentials/env_aws.go @@ -37,8 +37,7 @@ func NewEnvAWS() *Credentials { return New(&EnvAWS{}) } -// Retrieve retrieves the keys from the environment. -func (e *EnvAWS) Retrieve() (Value, error) { +func (e *EnvAWS) retrieve() (Value, error) { e.retrieved = false id := os.Getenv("AWS_ACCESS_KEY_ID") @@ -65,6 +64,16 @@ func (e *EnvAWS) Retrieve() (Value, error) { }, nil } +// Retrieve retrieves the keys from the environment. +func (e *EnvAWS) Retrieve() (Value, error) { + return e.retrieve() +} + +// RetrieveWithCredContext is like Retrieve (no-op input of Cred Context) +func (e *EnvAWS) RetrieveWithCredContext(_ *CredContext) (Value, error) { + return e.retrieve() +} + // IsExpired returns if the credentials have been retrieved. func (e *EnvAWS) IsExpired() bool { return !e.retrieved diff --git a/vendor/github.com/minio/minio-go/v7/pkg/credentials/env_minio.go b/vendor/github.com/minio/minio-go/v7/pkg/credentials/env_minio.go index 5bfeab140ae..dbfbdfcef1d 100644 --- a/vendor/github.com/minio/minio-go/v7/pkg/credentials/env_minio.go +++ b/vendor/github.com/minio/minio-go/v7/pkg/credentials/env_minio.go @@ -38,8 +38,7 @@ func NewEnvMinio() *Credentials { return New(&EnvMinio{}) } -// Retrieve retrieves the keys from the environment. -func (e *EnvMinio) Retrieve() (Value, error) { +func (e *EnvMinio) retrieve() (Value, error) { e.retrieved = false id := os.Getenv("MINIO_ROOT_USER") @@ -62,6 +61,16 @@ func (e *EnvMinio) Retrieve() (Value, error) { }, nil } +// Retrieve retrieves the keys from the environment. +func (e *EnvMinio) Retrieve() (Value, error) { + return e.retrieve() +} + +// RetrieveWithCredContext is like Retrieve() (no-op input cred context) +func (e *EnvMinio) RetrieveWithCredContext(_ *CredContext) (Value, error) { + return e.retrieve() +} + // IsExpired returns if the credentials have been retrieved. func (e *EnvMinio) IsExpired() bool { return !e.retrieved diff --git a/vendor/github.com/minio/minio-go/v7/pkg/credentials/file_aws_credentials.go b/vendor/github.com/minio/minio-go/v7/pkg/credentials/file_aws_credentials.go index 541e1a72f0f..0c83fc7fa4c 100644 --- a/vendor/github.com/minio/minio-go/v7/pkg/credentials/file_aws_credentials.go +++ b/vendor/github.com/minio/minio-go/v7/pkg/credentials/file_aws_credentials.go @@ -71,9 +71,7 @@ func NewFileAWSCredentials(filename, profile string) *Credentials { }) } -// Retrieve reads and extracts the shared credentials from the current -// users home directory. -func (p *FileAWSCredentials) Retrieve() (Value, error) { +func (p *FileAWSCredentials) retrieve() (Value, error) { if p.Filename == "" { p.Filename = os.Getenv("AWS_SHARED_CREDENTIALS_FILE") if p.Filename == "" { @@ -142,6 +140,17 @@ func (p *FileAWSCredentials) Retrieve() (Value, error) { }, nil } +// Retrieve reads and extracts the shared credentials from the current +// users home directory. +func (p *FileAWSCredentials) Retrieve() (Value, error) { + return p.retrieve() +} + +// RetrieveWithCredContext is like Retrieve(), cred context is no-op for File credentials +func (p *FileAWSCredentials) RetrieveWithCredContext(_ *CredContext) (Value, error) { + return p.retrieve() +} + // loadProfiles loads from the file pointed to by shared credentials filename for profile. // The credentials retrieved from the profile will be returned or error. Error will be // returned if it fails to read from the file, or the data is invalid. diff --git a/vendor/github.com/minio/minio-go/v7/pkg/credentials/file_minio_client.go b/vendor/github.com/minio/minio-go/v7/pkg/credentials/file_minio_client.go index 750e26ffa8b..5805281fe9e 100644 --- a/vendor/github.com/minio/minio-go/v7/pkg/credentials/file_minio_client.go +++ b/vendor/github.com/minio/minio-go/v7/pkg/credentials/file_minio_client.go @@ -56,9 +56,7 @@ func NewFileMinioClient(filename, alias string) *Credentials { }) } -// Retrieve reads and extracts the shared credentials from the current -// users home directory. -func (p *FileMinioClient) Retrieve() (Value, error) { +func (p *FileMinioClient) retrieve() (Value, error) { if p.Filename == "" { if value, ok := os.LookupEnv("MINIO_SHARED_CREDENTIALS_FILE"); ok { p.Filename = value @@ -96,6 +94,17 @@ func (p *FileMinioClient) Retrieve() (Value, error) { }, nil } +// Retrieve reads and extracts the shared credentials from the current +// users home directory. +func (p *FileMinioClient) Retrieve() (Value, error) { + return p.retrieve() +} + +// RetrieveWithCredContext - is like Retrieve() +func (p *FileMinioClient) RetrieveWithCredContext(_ *CredContext) (Value, error) { + return p.retrieve() +} + // IsExpired returns if the shared credentials have expired. func (p *FileMinioClient) IsExpired() bool { return !p.retrieved diff --git a/vendor/github.com/minio/minio-go/v7/pkg/credentials/iam_aws.go b/vendor/github.com/minio/minio-go/v7/pkg/credentials/iam_aws.go index ea4b3ef9375..e3230bb186d 100644 --- a/vendor/github.com/minio/minio-go/v7/pkg/credentials/iam_aws.go +++ b/vendor/github.com/minio/minio-go/v7/pkg/credentials/iam_aws.go @@ -49,7 +49,8 @@ const DefaultExpiryWindow = -1 type IAM struct { Expiry - // Required http Client to use when connecting to IAM metadata service. + // Optional http Client to use when connecting to IAM metadata service + // (overrides default client in CredContext) Client *http.Client // Custom endpoint to fetch IAM role credentials. @@ -90,17 +91,16 @@ const ( // NewIAM returns a pointer to a new Credentials object wrapping the IAM. func NewIAM(endpoint string) *Credentials { return New(&IAM{ - Client: &http.Client{ - Transport: http.DefaultTransport, - }, Endpoint: endpoint, }) } -// Retrieve retrieves credentials from the EC2 service. -// Error will be returned if the request fails, or unable to extract -// the desired -func (m *IAM) Retrieve() (Value, error) { +// RetrieveWithCredContext is like Retrieve with Cred Context +func (m *IAM) RetrieveWithCredContext(cc *CredContext) (Value, error) { + if cc == nil { + cc = defaultCredContext + } + token := os.Getenv("AWS_CONTAINER_AUTHORIZATION_TOKEN") if token == "" { token = m.Container.AuthorizationToken @@ -144,7 +144,16 @@ func (m *IAM) Retrieve() (Value, error) { var roleCreds ec2RoleCredRespBody var err error + client := m.Client + if client == nil { + client = cc.Client + } + if client == nil { + client = defaultCredContext.Client + } + endpoint := m.Endpoint + switch { case identityFile != "": if len(endpoint) == 0 { @@ -160,7 +169,7 @@ func (m *IAM) Retrieve() (Value, error) { } creds := &STSWebIdentity{ - Client: m.Client, + Client: client, STSEndpoint: endpoint, GetWebIDTokenExpiry: func() (*WebIdentityToken, error) { token, err := os.ReadFile(identityFile) @@ -174,7 +183,7 @@ func (m *IAM) Retrieve() (Value, error) { roleSessionName: roleSessionName, } - stsWebIdentityCreds, err := creds.Retrieve() + stsWebIdentityCreds, err := creds.RetrieveWithCredContext(cc) if err == nil { m.SetExpiration(creds.Expiration(), DefaultExpiryWindow) } @@ -185,11 +194,11 @@ func (m *IAM) Retrieve() (Value, error) { endpoint = fmt.Sprintf("%s%s", DefaultECSRoleEndpoint, relativeURI) } - roleCreds, err = getEcsTaskCredentials(m.Client, endpoint, token) + roleCreds, err = getEcsTaskCredentials(client, endpoint, token) case tokenFile != "" && fullURI != "": endpoint = fullURI - roleCreds, err = getEKSPodIdentityCredentials(m.Client, endpoint, tokenFile) + roleCreds, err = getEKSPodIdentityCredentials(client, endpoint, tokenFile) case fullURI != "": if len(endpoint) == 0 { @@ -203,10 +212,10 @@ func (m *IAM) Retrieve() (Value, error) { } } - roleCreds, err = getEcsTaskCredentials(m.Client, endpoint, token) + roleCreds, err = getEcsTaskCredentials(client, endpoint, token) default: - roleCreds, err = getCredentials(m.Client, endpoint) + roleCreds, err = getCredentials(client, endpoint) } if err != nil { @@ -224,6 +233,13 @@ func (m *IAM) Retrieve() (Value, error) { }, nil } +// Retrieve retrieves credentials from the EC2 service. +// Error will be returned if the request fails, or unable to extract +// the desired +func (m *IAM) Retrieve() (Value, error) { + return m.RetrieveWithCredContext(nil) +} + // A ec2RoleCredRespBody provides the shape for unmarshaling credential // request responses. type ec2RoleCredRespBody struct { diff --git a/vendor/github.com/minio/minio-go/v7/pkg/credentials/static.go b/vendor/github.com/minio/minio-go/v7/pkg/credentials/static.go index 7dde00b0a16..d90c98c84d5 100644 --- a/vendor/github.com/minio/minio-go/v7/pkg/credentials/static.go +++ b/vendor/github.com/minio/minio-go/v7/pkg/credentials/static.go @@ -59,6 +59,11 @@ func (s *Static) Retrieve() (Value, error) { return s.Value, nil } +// RetrieveWithCredContext returns the static credentials. +func (s *Static) RetrieveWithCredContext(_ *CredContext) (Value, error) { + return s.Retrieve() +} + // IsExpired returns if the credentials are expired. // // For Static, the credentials never expired. diff --git a/vendor/github.com/minio/minio-go/v7/pkg/credentials/sts_client_grants.go b/vendor/github.com/minio/minio-go/v7/pkg/credentials/sts_client_grants.go index 62bfbb6b02c..ef6f436b84b 100644 --- a/vendor/github.com/minio/minio-go/v7/pkg/credentials/sts_client_grants.go +++ b/vendor/github.com/minio/minio-go/v7/pkg/credentials/sts_client_grants.go @@ -72,7 +72,8 @@ type ClientGrantsToken struct { type STSClientGrants struct { Expiry - // Required http Client to use when connecting to MinIO STS service. + // Optional http Client to use when connecting to MinIO STS service. + // (overrides default client in CredContext) Client *http.Client // MinIO endpoint to fetch STS credentials. @@ -90,16 +91,10 @@ type STSClientGrants struct { // NewSTSClientGrants returns a pointer to a new // Credentials object wrapping the STSClientGrants. func NewSTSClientGrants(stsEndpoint string, getClientGrantsTokenExpiry func() (*ClientGrantsToken, error)) (*Credentials, error) { - if stsEndpoint == "" { - return nil, errors.New("STS endpoint cannot be empty") - } if getClientGrantsTokenExpiry == nil { return nil, errors.New("Client grants access token and expiry retrieval function should be defined") } return New(&STSClientGrants{ - Client: &http.Client{ - Transport: http.DefaultTransport, - }, STSEndpoint: stsEndpoint, GetClientGrantsTokenExpiry: getClientGrantsTokenExpiry, }), nil @@ -162,10 +157,29 @@ func getClientGrantsCredentials(clnt *http.Client, endpoint string, return a, nil } -// Retrieve retrieves credentials from the MinIO service. -// Error will be returned if the request fails. -func (m *STSClientGrants) Retrieve() (Value, error) { - a, err := getClientGrantsCredentials(m.Client, m.STSEndpoint, m.GetClientGrantsTokenExpiry) +// RetrieveWithCredContext is like Retrieve() with cred context +func (m *STSClientGrants) RetrieveWithCredContext(cc *CredContext) (Value, error) { + if cc == nil { + cc = defaultCredContext + } + + client := m.Client + if client == nil { + client = cc.Client + } + if client == nil { + client = defaultCredContext.Client + } + + stsEndpoint := m.STSEndpoint + if stsEndpoint == "" { + stsEndpoint = cc.Endpoint + } + if stsEndpoint == "" { + return Value{}, errors.New("STS endpoint unknown") + } + + a, err := getClientGrantsCredentials(client, stsEndpoint, m.GetClientGrantsTokenExpiry) if err != nil { return Value{}, err } @@ -181,3 +195,9 @@ func (m *STSClientGrants) Retrieve() (Value, error) { SignerType: SignatureV4, }, nil } + +// Retrieve retrieves credentials from the MinIO service. +// Error will be returned if the request fails. +func (m *STSClientGrants) Retrieve() (Value, error) { + return m.RetrieveWithCredContext(nil) +} diff --git a/vendor/github.com/minio/minio-go/v7/pkg/credentials/sts_custom_identity.go b/vendor/github.com/minio/minio-go/v7/pkg/credentials/sts_custom_identity.go index 75e1a77d322..162f460eea5 100644 --- a/vendor/github.com/minio/minio-go/v7/pkg/credentials/sts_custom_identity.go +++ b/vendor/github.com/minio/minio-go/v7/pkg/credentials/sts_custom_identity.go @@ -53,6 +53,8 @@ type AssumeRoleWithCustomTokenResponse struct { type CustomTokenIdentity struct { Expiry + // Optional http Client to use when connecting to MinIO STS service. + // (overrides default client in CredContext) Client *http.Client // MinIO server STS endpoint to fetch STS credentials. @@ -67,11 +69,26 @@ type CustomTokenIdentity struct { // RequestedExpiry is to set the validity of the generated credentials // (this value bounded by server). RequestedExpiry time.Duration + + // Optional, used for token revokation + TokenRevokeType string } -// Retrieve - to satisfy Provider interface; fetches credentials from MinIO. -func (c *CustomTokenIdentity) Retrieve() (value Value, err error) { - u, err := url.Parse(c.STSEndpoint) +// RetrieveWithCredContext with Retrieve optionally cred context +func (c *CustomTokenIdentity) RetrieveWithCredContext(cc *CredContext) (value Value, err error) { + if cc == nil { + cc = defaultCredContext + } + + stsEndpoint := c.STSEndpoint + if stsEndpoint == "" { + stsEndpoint = cc.Endpoint + } + if stsEndpoint == "" { + return Value{}, errors.New("STS endpoint unknown") + } + + u, err := url.Parse(stsEndpoint) if err != nil { return value, err } @@ -84,6 +101,9 @@ func (c *CustomTokenIdentity) Retrieve() (value Value, err error) { if c.RequestedExpiry != 0 { v.Set("DurationSeconds", fmt.Sprintf("%d", int(c.RequestedExpiry.Seconds()))) } + if c.TokenRevokeType != "" { + v.Set("TokenRevokeType", c.TokenRevokeType) + } u.RawQuery = v.Encode() @@ -92,7 +112,15 @@ func (c *CustomTokenIdentity) Retrieve() (value Value, err error) { return value, err } - resp, err := c.Client.Do(req) + client := c.Client + if client == nil { + client = cc.Client + } + if client == nil { + client = defaultCredContext.Client + } + + resp, err := client.Do(req) if err != nil { return value, err } @@ -118,11 +146,15 @@ func (c *CustomTokenIdentity) Retrieve() (value Value, err error) { }, nil } +// Retrieve - to satisfy Provider interface; fetches credentials from MinIO. +func (c *CustomTokenIdentity) Retrieve() (value Value, err error) { + return c.RetrieveWithCredContext(nil) +} + // NewCustomTokenCredentials - returns credentials using the // AssumeRoleWithCustomToken STS API. func NewCustomTokenCredentials(stsEndpoint, token, roleArn string, optFuncs ...CustomTokenOpt) (*Credentials, error) { c := CustomTokenIdentity{ - Client: &http.Client{Transport: http.DefaultTransport}, STSEndpoint: stsEndpoint, Token: token, RoleArn: roleArn, diff --git a/vendor/github.com/minio/minio-go/v7/pkg/credentials/sts_ldap_identity.go b/vendor/github.com/minio/minio-go/v7/pkg/credentials/sts_ldap_identity.go index b8df289f203..31fe10ae039 100644 --- a/vendor/github.com/minio/minio-go/v7/pkg/credentials/sts_ldap_identity.go +++ b/vendor/github.com/minio/minio-go/v7/pkg/credentials/sts_ldap_identity.go @@ -20,6 +20,7 @@ package credentials import ( "bytes" "encoding/xml" + "errors" "fmt" "io" "net/http" @@ -55,7 +56,8 @@ type LDAPIdentityResult struct { type LDAPIdentity struct { Expiry - // Required http Client to use when connecting to MinIO STS service. + // Optional http Client to use when connecting to MinIO STS service. + // (overrides default client in CredContext) Client *http.Client // Exported STS endpoint to fetch STS credentials. @@ -71,13 +73,15 @@ type LDAPIdentity struct { // RequestedExpiry is the configured expiry duration for credentials // requested from LDAP. RequestedExpiry time.Duration + + // Optional, used for token revokation + TokenRevokeType string } // NewLDAPIdentity returns new credentials object that uses LDAP // Identity. func NewLDAPIdentity(stsEndpoint, ldapUsername, ldapPassword string, optFuncs ...LDAPIdentityOpt) (*Credentials, error) { l := LDAPIdentity{ - Client: &http.Client{Transport: http.DefaultTransport}, STSEndpoint: stsEndpoint, LDAPUsername: ldapUsername, LDAPPassword: ldapPassword, @@ -113,7 +117,6 @@ func LDAPIdentityExpiryOpt(d time.Duration) LDAPIdentityOpt { // Deprecated: Use the `LDAPIdentityPolicyOpt` with `NewLDAPIdentity` instead. func NewLDAPIdentityWithSessionPolicy(stsEndpoint, ldapUsername, ldapPassword, policy string) (*Credentials, error) { return New(&LDAPIdentity{ - Client: &http.Client{Transport: http.DefaultTransport}, STSEndpoint: stsEndpoint, LDAPUsername: ldapUsername, LDAPPassword: ldapPassword, @@ -121,10 +124,22 @@ func NewLDAPIdentityWithSessionPolicy(stsEndpoint, ldapUsername, ldapPassword, p }), nil } -// Retrieve gets the credential by calling the MinIO STS API for +// RetrieveWithCredContext gets the credential by calling the MinIO STS API for // LDAP on the configured stsEndpoint. -func (k *LDAPIdentity) Retrieve() (value Value, err error) { - u, err := url.Parse(k.STSEndpoint) +func (k *LDAPIdentity) RetrieveWithCredContext(cc *CredContext) (value Value, err error) { + if cc == nil { + cc = defaultCredContext + } + + stsEndpoint := k.STSEndpoint + if stsEndpoint == "" { + stsEndpoint = cc.Endpoint + } + if stsEndpoint == "" { + return Value{}, errors.New("STS endpoint unknown") + } + + u, err := url.Parse(stsEndpoint) if err != nil { return value, err } @@ -140,6 +155,9 @@ func (k *LDAPIdentity) Retrieve() (value Value, err error) { if k.RequestedExpiry != 0 { v.Set("DurationSeconds", fmt.Sprintf("%d", int(k.RequestedExpiry.Seconds()))) } + if k.TokenRevokeType != "" { + v.Set("TokenRevokeType", k.TokenRevokeType) + } req, err := http.NewRequest(http.MethodPost, u.String(), strings.NewReader(v.Encode())) if err != nil { @@ -148,7 +166,15 @@ func (k *LDAPIdentity) Retrieve() (value Value, err error) { req.Header.Set("Content-Type", "application/x-www-form-urlencoded") - resp, err := k.Client.Do(req) + client := k.Client + if client == nil { + client = cc.Client + } + if client == nil { + client = defaultCredContext.Client + } + + resp, err := client.Do(req) if err != nil { return value, err } @@ -188,3 +214,9 @@ func (k *LDAPIdentity) Retrieve() (value Value, err error) { SignerType: SignatureV4, }, nil } + +// Retrieve gets the credential by calling the MinIO STS API for +// LDAP on the configured stsEndpoint. +func (k *LDAPIdentity) Retrieve() (value Value, err error) { + return k.RetrieveWithCredContext(defaultCredContext) +} diff --git a/vendor/github.com/minio/minio-go/v7/pkg/credentials/sts_tls_identity.go b/vendor/github.com/minio/minio-go/v7/pkg/credentials/sts_tls_identity.go index 10083502d1d..2a35a51a435 100644 --- a/vendor/github.com/minio/minio-go/v7/pkg/credentials/sts_tls_identity.go +++ b/vendor/github.com/minio/minio-go/v7/pkg/credentials/sts_tls_identity.go @@ -20,8 +20,8 @@ import ( "crypto/tls" "encoding/xml" "errors" + "fmt" "io" - "net" "net/http" "net/url" "strconv" @@ -36,7 +36,12 @@ type CertificateIdentityOption func(*STSCertificateIdentity) // CertificateIdentityWithTransport returns a CertificateIdentityOption that // customizes the STSCertificateIdentity with the given http.RoundTripper. func CertificateIdentityWithTransport(t http.RoundTripper) CertificateIdentityOption { - return CertificateIdentityOption(func(i *STSCertificateIdentity) { i.Client.Transport = t }) + return CertificateIdentityOption(func(i *STSCertificateIdentity) { + if i.Client == nil { + i.Client = &http.Client{} + } + i.Client.Transport = t + }) } // CertificateIdentityWithExpiry returns a CertificateIdentityOption that @@ -53,6 +58,10 @@ func CertificateIdentityWithExpiry(livetime time.Duration) CertificateIdentityOp type STSCertificateIdentity struct { Expiry + // Optional http Client to use when connecting to MinIO STS service. + // (overrides default client in CredContext) + Client *http.Client + // STSEndpoint is the base URL endpoint of the STS API. // For example, https://minio.local:9000 STSEndpoint string @@ -68,50 +77,21 @@ type STSCertificateIdentity struct { // The default livetime is one hour. S3CredentialLivetime time.Duration - // Client is the HTTP client used to authenticate and fetch - // S3 credentials. - // - // A custom TLS client configuration can be specified by - // using a custom http.Transport: - // Client: http.Client { - // Transport: &http.Transport{ - // TLSClientConfig: &tls.Config{}, - // }, - // } - Client http.Client -} + // Certificate is the client certificate that is used for + // STS authentication. + Certificate tls.Certificate -var _ Provider = (*STSWebIdentity)(nil) // compiler check + // Optional, used for token revokation + TokenRevokeType string +} // NewSTSCertificateIdentity returns a STSCertificateIdentity that authenticates // to the given STS endpoint with the given TLS certificate and retrieves and // rotates S3 credentials. func NewSTSCertificateIdentity(endpoint string, certificate tls.Certificate, options ...CertificateIdentityOption) (*Credentials, error) { - if endpoint == "" { - return nil, errors.New("STS endpoint cannot be empty") - } - if _, err := url.Parse(endpoint); err != nil { - return nil, err - } identity := &STSCertificateIdentity{ STSEndpoint: endpoint, - Client: http.Client{ - Transport: &http.Transport{ - Proxy: http.ProxyFromEnvironment, - DialContext: (&net.Dialer{ - Timeout: 30 * time.Second, - KeepAlive: 30 * time.Second, - }).DialContext, - ForceAttemptHTTP2: true, - MaxIdleConns: 100, - IdleConnTimeout: 90 * time.Second, - TLSHandshakeTimeout: 10 * time.Second, - ExpectContinueTimeout: 5 * time.Second, - TLSClientConfig: &tls.Config{ - Certificates: []tls.Certificate{certificate}, - }, - }, - }, + Certificate: certificate, } for _, option := range options { option(identity) @@ -119,10 +99,21 @@ func NewSTSCertificateIdentity(endpoint string, certificate tls.Certificate, opt return New(identity), nil } -// Retrieve fetches a new set of S3 credentials from the configured -// STS API endpoint. -func (i *STSCertificateIdentity) Retrieve() (Value, error) { - endpointURL, err := url.Parse(i.STSEndpoint) +// RetrieveWithCredContext is Retrieve with cred context +func (i *STSCertificateIdentity) RetrieveWithCredContext(cc *CredContext) (Value, error) { + if cc == nil { + cc = defaultCredContext + } + + stsEndpoint := i.STSEndpoint + if stsEndpoint == "" { + stsEndpoint = cc.Endpoint + } + if stsEndpoint == "" { + return Value{}, errors.New("STS endpoint unknown") + } + + endpointURL, err := url.Parse(stsEndpoint) if err != nil { return Value{}, err } @@ -134,6 +125,9 @@ func (i *STSCertificateIdentity) Retrieve() (Value, error) { queryValues := url.Values{} queryValues.Set("Action", "AssumeRoleWithCertificate") queryValues.Set("Version", STSVersion) + if i.TokenRevokeType != "" { + queryValues.Set("TokenRevokeType", i.TokenRevokeType) + } endpointURL.RawQuery = queryValues.Encode() req, err := http.NewRequest(http.MethodPost, endpointURL.String(), nil) @@ -145,7 +139,28 @@ func (i *STSCertificateIdentity) Retrieve() (Value, error) { } req.Form.Add("DurationSeconds", strconv.FormatUint(uint64(livetime.Seconds()), 10)) - resp, err := i.Client.Do(req) + client := i.Client + if client == nil { + client = cc.Client + } + if client == nil { + client = defaultCredContext.Client + } + + tr, ok := client.Transport.(*http.Transport) + if !ok { + return Value{}, fmt.Errorf("CredContext should contain an http.Transport value") + } + + // Clone the HTTP transport (patch the TLS client certificate) + trCopy := tr.Clone() + trCopy.TLSClientConfig.Certificates = []tls.Certificate{i.Certificate} + + // Clone the HTTP client (patch the HTTP transport) + clientCopy := *client + clientCopy.Transport = trCopy + + resp, err := clientCopy.Do(req) if err != nil { return Value{}, err } @@ -193,6 +208,11 @@ func (i *STSCertificateIdentity) Retrieve() (Value, error) { }, nil } +// Retrieve fetches a new set of S3 credentials from the configured STS API endpoint. +func (i *STSCertificateIdentity) Retrieve() (Value, error) { + return i.RetrieveWithCredContext(defaultCredContext) +} + // Expiration returns the expiration time of the current S3 credentials. func (i *STSCertificateIdentity) Expiration() time.Time { return i.expiration } diff --git a/vendor/github.com/minio/minio-go/v7/pkg/credentials/sts_web_identity.go b/vendor/github.com/minio/minio-go/v7/pkg/credentials/sts_web_identity.go index 8c06bac60db..a9987255ec7 100644 --- a/vendor/github.com/minio/minio-go/v7/pkg/credentials/sts_web_identity.go +++ b/vendor/github.com/minio/minio-go/v7/pkg/credentials/sts_web_identity.go @@ -69,7 +69,8 @@ type WebIdentityToken struct { type STSWebIdentity struct { Expiry - // Required http Client to use when connecting to MinIO STS service. + // Optional http Client to use when connecting to MinIO STS service. + // (overrides default client in CredContext) Client *http.Client // Exported STS endpoint to fetch STS credentials. @@ -92,21 +93,18 @@ type STSWebIdentity struct { // roleSessionName is the identifier for the assumed role session. roleSessionName string + + // Optional, used for token revokation + TokenRevokeType string } // NewSTSWebIdentity returns a pointer to a new // Credentials object wrapping the STSWebIdentity. func NewSTSWebIdentity(stsEndpoint string, getWebIDTokenExpiry func() (*WebIdentityToken, error), opts ...func(*STSWebIdentity)) (*Credentials, error) { - if stsEndpoint == "" { - return nil, errors.New("STS endpoint cannot be empty") - } if getWebIDTokenExpiry == nil { return nil, errors.New("Web ID token and expiry retrieval function should be defined") } i := &STSWebIdentity{ - Client: &http.Client{ - Transport: http.DefaultTransport, - }, STSEndpoint: stsEndpoint, GetWebIDTokenExpiry: getWebIDTokenExpiry, } @@ -140,7 +138,7 @@ func WithPolicy(policy string) func(*STSWebIdentity) { } func getWebIdentityCredentials(clnt *http.Client, endpoint, roleARN, roleSessionName string, policy string, - getWebIDTokenExpiry func() (*WebIdentityToken, error), + getWebIDTokenExpiry func() (*WebIdentityToken, error), tokenRevokeType string, ) (AssumeRoleWithWebIdentityResponse, error) { idToken, err := getWebIDTokenExpiry() if err != nil { @@ -173,6 +171,9 @@ func getWebIdentityCredentials(clnt *http.Client, endpoint, roleARN, roleSession v.Set("Policy", policy) } v.Set("Version", STSVersion) + if tokenRevokeType != "" { + v.Set("TokenRevokeType", tokenRevokeType) + } u, err := url.Parse(endpoint) if err != nil { @@ -219,10 +220,29 @@ func getWebIdentityCredentials(clnt *http.Client, endpoint, roleARN, roleSession return a, nil } -// Retrieve retrieves credentials from the MinIO service. -// Error will be returned if the request fails. -func (m *STSWebIdentity) Retrieve() (Value, error) { - a, err := getWebIdentityCredentials(m.Client, m.STSEndpoint, m.RoleARN, m.roleSessionName, m.Policy, m.GetWebIDTokenExpiry) +// RetrieveWithCredContext is like Retrieve with optional cred context. +func (m *STSWebIdentity) RetrieveWithCredContext(cc *CredContext) (Value, error) { + if cc == nil { + cc = defaultCredContext + } + + client := m.Client + if client == nil { + client = cc.Client + } + if client == nil { + client = defaultCredContext.Client + } + + stsEndpoint := m.STSEndpoint + if stsEndpoint == "" { + stsEndpoint = cc.Endpoint + } + if stsEndpoint == "" { + return Value{}, errors.New("STS endpoint unknown") + } + + a, err := getWebIdentityCredentials(client, stsEndpoint, m.RoleARN, m.roleSessionName, m.Policy, m.GetWebIDTokenExpiry, m.TokenRevokeType) if err != nil { return Value{}, err } @@ -239,6 +259,12 @@ func (m *STSWebIdentity) Retrieve() (Value, error) { }, nil } +// Retrieve retrieves credentials from the MinIO service. +// Error will be returned if the request fails. +func (m *STSWebIdentity) Retrieve() (Value, error) { + return m.RetrieveWithCredContext(nil) +} + // Expiration returns the expiration time of the credentials func (m *STSWebIdentity) Expiration() time.Time { return m.expiration diff --git a/vendor/github.com/minio/minio-go/v7/pkg/lifecycle/lifecycle.go b/vendor/github.com/minio/minio-go/v7/pkg/lifecycle/lifecycle.go index 344af2b780f..7ed98b0d133 100644 --- a/vendor/github.com/minio/minio-go/v7/pkg/lifecycle/lifecycle.go +++ b/vendor/github.com/minio/minio-go/v7/pkg/lifecycle/lifecycle.go @@ -192,7 +192,7 @@ func (t Transition) IsDaysNull() bool { // IsDateNull returns true if date field is null func (t Transition) IsDateNull() bool { - return t.Date.Time.IsZero() + return t.Date.IsZero() } // IsNull returns true if no storage-class is set. @@ -323,7 +323,7 @@ type ExpirationDate struct { // MarshalXML encodes expiration date if it is non-zero and encodes // empty string otherwise func (eDate ExpirationDate) MarshalXML(e *xml.Encoder, startElement xml.StartElement) error { - if eDate.Time.IsZero() { + if eDate.IsZero() { return nil } return e.EncodeElement(eDate.Format(time.RFC3339), startElement) @@ -392,7 +392,7 @@ func (e Expiration) IsDaysNull() bool { // IsDateNull returns true if date field is null func (e Expiration) IsDateNull() bool { - return e.Date.Time.IsZero() + return e.Date.IsZero() } // IsDeleteMarkerExpirationEnabled returns true if the auto-expiration of delete marker is enabled diff --git a/vendor/github.com/minio/minio-go/v7/pkg/notification/notification.go b/vendor/github.com/minio/minio-go/v7/pkg/notification/notification.go index 151ca21e88f..31f29bcb104 100644 --- a/vendor/github.com/minio/minio-go/v7/pkg/notification/notification.go +++ b/vendor/github.com/minio/minio-go/v7/pkg/notification/notification.go @@ -283,7 +283,6 @@ func (b *Configuration) AddTopic(topicConfig Config) bool { for _, n := range b.TopicConfigs { // If new config matches existing one if n.Topic == newTopicConfig.Arn.String() && newTopicConfig.Filter == n.Filter { - existingConfig := set.NewStringSet() for _, v := range n.Events { existingConfig.Add(string(v)) @@ -308,7 +307,6 @@ func (b *Configuration) AddQueue(queueConfig Config) bool { newQueueConfig := QueueConfig{Config: queueConfig, Queue: queueConfig.Arn.String()} for _, n := range b.QueueConfigs { if n.Queue == newQueueConfig.Arn.String() && newQueueConfig.Filter == n.Filter { - existingConfig := set.NewStringSet() for _, v := range n.Events { existingConfig.Add(string(v)) @@ -333,7 +331,6 @@ func (b *Configuration) AddLambda(lambdaConfig Config) bool { newLambdaConfig := LambdaConfig{Config: lambdaConfig, Lambda: lambdaConfig.Arn.String()} for _, n := range b.LambdaConfigs { if n.Lambda == newLambdaConfig.Arn.String() && newLambdaConfig.Filter == n.Filter { - existingConfig := set.NewStringSet() for _, v := range n.Events { existingConfig.Add(string(v)) @@ -372,7 +369,7 @@ func (b *Configuration) RemoveTopicByArnEventsPrefixSuffix(arn Arn, events []Eve removeIndex := -1 for i, v := range b.TopicConfigs { // if it matches events and filters, mark the index for deletion - if v.Topic == arn.String() && v.Config.Equal(events, prefix, suffix) { + if v.Topic == arn.String() && v.Equal(events, prefix, suffix) { removeIndex = i break // since we have at most one matching config } @@ -400,7 +397,7 @@ func (b *Configuration) RemoveQueueByArnEventsPrefixSuffix(arn Arn, events []Eve removeIndex := -1 for i, v := range b.QueueConfigs { // if it matches events and filters, mark the index for deletion - if v.Queue == arn.String() && v.Config.Equal(events, prefix, suffix) { + if v.Queue == arn.String() && v.Equal(events, prefix, suffix) { removeIndex = i break // since we have at most one matching config } @@ -428,7 +425,7 @@ func (b *Configuration) RemoveLambdaByArnEventsPrefixSuffix(arn Arn, events []Ev removeIndex := -1 for i, v := range b.LambdaConfigs { // if it matches events and filters, mark the index for deletion - if v.Lambda == arn.String() && v.Config.Equal(events, prefix, suffix) { + if v.Lambda == arn.String() && v.Equal(events, prefix, suffix) { removeIndex = i break // since we have at most one matching config } diff --git a/vendor/github.com/minio/minio-go/v7/pkg/replication/replication.go b/vendor/github.com/minio/minio-go/v7/pkg/replication/replication.go index 65a2f75e94a..55636ad481e 100644 --- a/vendor/github.com/minio/minio-go/v7/pkg/replication/replication.go +++ b/vendor/github.com/minio/minio-go/v7/pkg/replication/replication.go @@ -868,8 +868,20 @@ type ReplQNodeStats struct { XferStats map[MetricName]XferStats `json:"transferSummary"` TgtXferStats map[string]map[MetricName]XferStats `json:"tgtTransferStats"` - QStats InQueueMetric `json:"queueStats"` - MRFStats ReplMRFStats `json:"mrfStats"` + QStats InQueueMetric `json:"queueStats"` + MRFStats ReplMRFStats `json:"mrfStats"` + Retries CounterSummary `json:"retries"` + Errors CounterSummary `json:"errors"` +} + +// CounterSummary denotes the stats counter summary +type CounterSummary struct { + // Counted last 1hr + Last1hr uint64 `json:"last1hr"` + // Counted last 1m + Last1m uint64 `json:"last1m"` + // Total counted since uptime + Total uint64 `json:"total"` } // ReplQueueStats holds stats for replication queue across nodes @@ -914,8 +926,10 @@ type ReplQStats struct { XferStats map[MetricName]XferStats `json:"xferStats"` TgtXferStats map[string]map[MetricName]XferStats `json:"tgtXferStats"` - QStats InQueueMetric `json:"qStats"` - MRFStats ReplMRFStats `json:"mrfStats"` + QStats InQueueMetric `json:"qStats"` + MRFStats ReplMRFStats `json:"mrfStats"` + Retries CounterSummary `json:"retries"` + Errors CounterSummary `json:"errors"` } // QStats returns cluster level stats for objects in replication queue @@ -958,6 +972,12 @@ func (q ReplQueueStats) QStats() (r ReplQStats) { r.MRFStats.LastFailedCount += node.MRFStats.LastFailedCount r.MRFStats.TotalDroppedCount += node.MRFStats.TotalDroppedCount r.MRFStats.TotalDroppedBytes += node.MRFStats.TotalDroppedBytes + r.Retries.Last1hr += node.Retries.Last1hr + r.Retries.Last1m += node.Retries.Last1m + r.Retries.Total += node.Retries.Total + r.Errors.Last1hr += node.Errors.Last1hr + r.Errors.Last1m += node.Errors.Last1m + r.Errors.Total += node.Errors.Total r.Uptime += node.Uptime } if len(q.Nodes) > 0 { @@ -968,7 +988,21 @@ func (q ReplQueueStats) QStats() (r ReplQStats) { // MetricsV2 represents replication metrics for a bucket. type MetricsV2 struct { - Uptime int64 `json:"uptime"` - CurrentStats Metrics `json:"currStats"` - QueueStats ReplQueueStats `json:"queueStats"` + Uptime int64 `json:"uptime"` + CurrentStats Metrics `json:"currStats"` + QueueStats ReplQueueStats `json:"queueStats"` + DowntimeInfo map[string]DowntimeInfo `json:"downtimeInfo"` +} + +// DowntimeInfo represents the downtime info +type DowntimeInfo struct { + Duration Stat `json:"duration"` + Count Stat `json:"count"` +} + +// Stat represents the aggregates +type Stat struct { + Total int64 `json:"total"` + Avg int64 `json:"avg"` + Max int64 `json:"max"` } diff --git a/vendor/github.com/minio/minio-go/v7/pkg/s3utils/utils.go b/vendor/github.com/minio/minio-go/v7/pkg/s3utils/utils.go index 0e63ce2f7dc..eb631249b4a 100644 --- a/vendor/github.com/minio/minio-go/v7/pkg/s3utils/utils.go +++ b/vendor/github.com/minio/minio-go/v7/pkg/s3utils/utils.go @@ -118,53 +118,53 @@ func GetRegionFromURL(endpointURL url.URL) string { if endpointURL == sentinelURL { return "" } - if endpointURL.Host == "s3-external-1.amazonaws.com" { + if endpointURL.Hostname() == "s3-external-1.amazonaws.com" { return "" } // if elb's are used we cannot calculate which region it may be, just return empty. - if elbAmazonRegex.MatchString(endpointURL.Host) || elbAmazonCnRegex.MatchString(endpointURL.Host) { + if elbAmazonRegex.MatchString(endpointURL.Hostname()) || elbAmazonCnRegex.MatchString(endpointURL.Hostname()) { return "" } // We check for FIPS dualstack matching first to avoid the non-greedy // regex for FIPS non-dualstack matching a dualstack URL - parts := amazonS3HostFIPSDualStack.FindStringSubmatch(endpointURL.Host) + parts := amazonS3HostFIPSDualStack.FindStringSubmatch(endpointURL.Hostname()) if len(parts) > 1 { return parts[1] } - parts = amazonS3HostFIPS.FindStringSubmatch(endpointURL.Host) + parts = amazonS3HostFIPS.FindStringSubmatch(endpointURL.Hostname()) if len(parts) > 1 { return parts[1] } - parts = amazonS3HostDualStack.FindStringSubmatch(endpointURL.Host) + parts = amazonS3HostDualStack.FindStringSubmatch(endpointURL.Hostname()) if len(parts) > 1 { return parts[1] } - parts = amazonS3HostHyphen.FindStringSubmatch(endpointURL.Host) + parts = amazonS3HostHyphen.FindStringSubmatch(endpointURL.Hostname()) if len(parts) > 1 { return parts[1] } - parts = amazonS3ChinaHost.FindStringSubmatch(endpointURL.Host) + parts = amazonS3ChinaHost.FindStringSubmatch(endpointURL.Hostname()) if len(parts) > 1 { return parts[1] } - parts = amazonS3ChinaHostDualStack.FindStringSubmatch(endpointURL.Host) + parts = amazonS3ChinaHostDualStack.FindStringSubmatch(endpointURL.Hostname()) if len(parts) > 1 { return parts[1] } - parts = amazonS3HostDot.FindStringSubmatch(endpointURL.Host) + parts = amazonS3HostDot.FindStringSubmatch(endpointURL.Hostname()) if len(parts) > 1 { return parts[1] } - parts = amazonS3HostPrivateLink.FindStringSubmatch(endpointURL.Host) + parts = amazonS3HostPrivateLink.FindStringSubmatch(endpointURL.Hostname()) if len(parts) > 1 { return parts[1] } @@ -218,7 +218,7 @@ func IsAmazonPrivateLinkEndpoint(endpointURL url.URL) bool { if endpointURL == sentinelURL { return false } - return amazonS3HostPrivateLink.MatchString(endpointURL.Host) + return amazonS3HostPrivateLink.MatchString(endpointURL.Hostname()) } // IsGoogleEndpoint - Match if it is exactly Google cloud storage endpoint. @@ -261,44 +261,6 @@ func QueryEncode(v url.Values) string { return buf.String() } -// TagDecode - decodes canonical tag into map of key and value. -func TagDecode(ctag string) map[string]string { - if ctag == "" { - return map[string]string{} - } - tags := strings.Split(ctag, "&") - tagMap := make(map[string]string, len(tags)) - var err error - for _, tag := range tags { - kvs := strings.SplitN(tag, "=", 2) - if len(kvs) == 0 { - return map[string]string{} - } - if len(kvs) == 1 { - return map[string]string{} - } - tagMap[kvs[0]], err = url.PathUnescape(kvs[1]) - if err != nil { - continue - } - } - return tagMap -} - -// TagEncode - encodes tag values in their URL encoded form. In -// addition to the percent encoding performed by urlEncodePath() used -// here, it also percent encodes '/' (forward slash) -func TagEncode(tags map[string]string) string { - if tags == nil { - return "" - } - values := url.Values{} - for k, v := range tags { - values[k] = []string{v} - } - return QueryEncode(values) -} - // if object matches reserved string, no need to encode them var reservedObjectNames = regexp.MustCompile("^[a-zA-Z0-9-_.~/]+$") diff --git a/vendor/github.com/minio/minio-go/v7/pkg/signer/request-signature-streaming-unsigned-trailer.go b/vendor/github.com/minio/minio-go/v7/pkg/signer/request-signature-streaming-unsigned-trailer.go index 77540e2d821..e18002b8d53 100644 --- a/vendor/github.com/minio/minio-go/v7/pkg/signer/request-signature-streaming-unsigned-trailer.go +++ b/vendor/github.com/minio/minio-go/v7/pkg/signer/request-signature-streaming-unsigned-trailer.go @@ -212,7 +212,6 @@ func (s *StreamingUSReader) Read(buf []byte) (int, error) { } return 0, err } - } } return s.buf.Read(buf) diff --git a/vendor/github.com/minio/minio-go/v7/pkg/signer/request-signature-streaming.go b/vendor/github.com/minio/minio-go/v7/pkg/signer/request-signature-streaming.go index 1c2f1dc9d14..fcd0dfd7645 100644 --- a/vendor/github.com/minio/minio-go/v7/pkg/signer/request-signature-streaming.go +++ b/vendor/github.com/minio/minio-go/v7/pkg/signer/request-signature-streaming.go @@ -387,7 +387,6 @@ func (s *StreamingReader) Read(buf []byte) (int, error) { } return 0, err } - } } return s.buf.Read(buf) diff --git a/vendor/github.com/minio/minio-go/v7/pkg/signer/request-signature-v2.go b/vendor/github.com/minio/minio-go/v7/pkg/signer/request-signature-v2.go index fa4f8c91e6c..f65c36c7d3d 100644 --- a/vendor/github.com/minio/minio-go/v7/pkg/signer/request-signature-v2.go +++ b/vendor/github.com/minio/minio-go/v7/pkg/signer/request-signature-v2.go @@ -148,7 +148,7 @@ func SignV2(req http.Request, accessKeyID, secretAccessKey string, virtualHost b // Prepare auth header. authHeader := new(bytes.Buffer) - authHeader.WriteString(fmt.Sprintf("%s %s:", signV2Algorithm, accessKeyID)) + fmt.Fprintf(authHeader, "%s %s:", signV2Algorithm, accessKeyID) encoder := base64.NewEncoder(base64.StdEncoding, authHeader) encoder.Write(hm.Sum(nil)) encoder.Close() diff --git a/vendor/github.com/minio/minio-go/v7/pkg/signer/request-signature-v4.go b/vendor/github.com/minio/minio-go/v7/pkg/signer/request-signature-v4.go index ffd2514512c..f6d459edcc2 100644 --- a/vendor/github.com/minio/minio-go/v7/pkg/signer/request-signature-v4.go +++ b/vendor/github.com/minio/minio-go/v7/pkg/signer/request-signature-v4.go @@ -128,8 +128,8 @@ func getCanonicalHeaders(req http.Request, ignoredHeaders map[string]bool) strin for _, k := range headers { buf.WriteString(k) buf.WriteByte(':') - switch { - case k == "host": + switch k { + case "host": buf.WriteString(getHostAddr(&req)) buf.WriteByte('\n') default: @@ -338,6 +338,29 @@ func signV4(req http.Request, accessKeyID, secretAccessKey, sessionToken, locati return &req } +// UnsignedTrailer will do chunked encoding with a custom trailer. +func UnsignedTrailer(req http.Request, trailer http.Header) *http.Request { + if len(trailer) == 0 { + return &req + } + // Initial time. + t := time.Now().UTC() + + // Set x-amz-date. + req.Header.Set("X-Amz-Date", t.Format(iso8601DateFormat)) + + for k := range trailer { + req.Header.Add("X-Amz-Trailer", strings.ToLower(k)) + } + + req.Header.Set("Content-Encoding", "aws-chunked") + req.Header.Set("x-amz-decoded-content-length", strconv.FormatInt(req.ContentLength, 10)) + + // Use custom chunked encoding. + req.Trailer = trailer + return StreamingUnsignedV4(&req, "", req.ContentLength, t) +} + // SignV4 sign the request before Do(), in accordance with // http://docs.aws.amazon.com/AmazonS3/latest/API/sig-v4-authenticating-requests.html. func SignV4(req http.Request, accessKeyID, secretAccessKey, sessionToken, location string) *http.Request { diff --git a/vendor/github.com/minio/minio-go/v7/retry-continous.go b/vendor/github.com/minio/minio-go/v7/retry-continous.go index 81fcf16f1b9..21e9fd455e5 100644 --- a/vendor/github.com/minio/minio-go/v7/retry-continous.go +++ b/vendor/github.com/minio/minio-go/v7/retry-continous.go @@ -17,12 +17,14 @@ package minio -import "time" +import ( + "iter" + "math" + "time" +) // newRetryTimerContinous creates a timer with exponentially increasing delays forever. -func (c *Client) newRetryTimerContinous(baseSleep, maxSleep time.Duration, jitter float64, doneCh chan struct{}) <-chan int { - attemptCh := make(chan int) - +func (c *Client) newRetryTimerContinous(baseSleep, maxSleep time.Duration, jitter float64) iter.Seq[int] { // normalize jitter to the range [0, 1.0] if jitter < NoJitter { jitter = NoJitter @@ -44,26 +46,20 @@ func (c *Client) newRetryTimerContinous(baseSleep, maxSleep time.Duration, jitte if sleep > maxSleep { sleep = maxSleep } - if jitter != NoJitter { + if math.Abs(jitter-NoJitter) > 1e-9 { sleep -= time.Duration(c.random.Float64() * float64(sleep) * jitter) } return sleep } - go func() { - defer close(attemptCh) + return func(yield func(int) bool) { var nextBackoff int for { - select { - // Attempts starts. - case attemptCh <- nextBackoff: - nextBackoff++ - case <-doneCh: - // Stop the routine. + if !yield(nextBackoff) { return } + nextBackoff++ time.Sleep(exponentialBackoffWait(nextBackoff)) } - }() - return attemptCh + } } diff --git a/vendor/github.com/minio/minio-go/v7/retry.go b/vendor/github.com/minio/minio-go/v7/retry.go index 4cc45920c4a..b83d1b2e5d0 100644 --- a/vendor/github.com/minio/minio-go/v7/retry.go +++ b/vendor/github.com/minio/minio-go/v7/retry.go @@ -21,6 +21,8 @@ import ( "context" "crypto/x509" "errors" + "iter" + "math" "net/http" "net/url" "time" @@ -45,9 +47,7 @@ var DefaultRetryCap = time.Second // newRetryTimer creates a timer with exponentially increasing // delays until the maximum retry attempts are reached. -func (c *Client) newRetryTimer(ctx context.Context, maxRetry int, baseSleep, maxSleep time.Duration, jitter float64) <-chan int { - attemptCh := make(chan int) - +func (c *Client) newRetryTimer(ctx context.Context, maxRetry int, baseSleep, maxSleep time.Duration, jitter float64) iter.Seq[int] { // computes the exponential backoff duration according to // https://www.awsarchitectureblog.com/2015/03/backoff.html exponentialBackoffWait := func(attempt int) time.Duration { @@ -64,18 +64,22 @@ func (c *Client) newRetryTimer(ctx context.Context, maxRetry int, baseSleep, max if sleep > maxSleep { sleep = maxSleep } - if jitter != NoJitter { + if math.Abs(jitter-NoJitter) > 1e-9 { sleep -= time.Duration(c.random.Float64() * float64(sleep) * jitter) } return sleep } - go func() { - defer close(attemptCh) - for i := 0; i < maxRetry; i++ { - select { - case attemptCh <- i + 1: - case <-ctx.Done(): + return func(yield func(int) bool) { + // if context is already canceled, skip yield + select { + case <-ctx.Done(): + return + default: + } + + for i := range maxRetry { + if !yield(i) { return } @@ -85,8 +89,7 @@ func (c *Client) newRetryTimer(ctx context.Context, maxRetry int, baseSleep, max return } } - }() - return attemptCh + } } // List of AWS S3 error codes which are retryable. @@ -112,6 +115,7 @@ func isS3CodeRetryable(s3Code string) (ok bool) { // List of HTTP status codes which are retryable. var retryableHTTPStatusCodes = map[int]struct{}{ + http.StatusRequestTimeout: {}, 429: {}, // http.StatusTooManyRequests is not part of the Go 1.5 library, yet 499: {}, // client closed request, retry. A non-standard status code introduced by nginx. http.StatusInternalServerError: {}, diff --git a/vendor/github.com/minio/minio-go/v7/s3-endpoints.go b/vendor/github.com/minio/minio-go/v7/s3-endpoints.go index 01cee8a19df..baab23e9613 100644 --- a/vendor/github.com/minio/minio-go/v7/s3-endpoints.go +++ b/vendor/github.com/minio/minio-go/v7/s3-endpoints.go @@ -32,6 +32,18 @@ var awsS3EndpointMap = map[string]awsS3Endpoint{ "s3.us-east-2.amazonaws.com", "s3.dualstack.us-east-2.amazonaws.com", }, + "us-iso-east-1": { + "s3.us-iso-east-1.c2s.ic.gov", + "s3.dualstack.us-iso-east-1.c2s.ic.gov", + }, + "us-isob-east-1": { + "s3.us-isob-east-1.sc2s.sgov.gov", + "s3.dualstack.us-isob-east-1.sc2s.sgov.gov", + }, + "us-iso-west-1": { + "s3.us-iso-west-1.c2s.ic.gov", + "s3.dualstack.us-iso-west-1.c2s.ic.gov", + }, "us-west-2": { "s3.us-west-2.amazonaws.com", "s3.dualstack.us-west-2.amazonaws.com", diff --git a/vendor/github.com/minio/minio-go/v7/utils.go b/vendor/github.com/minio/minio-go/v7/utils.go index cd7d2c27e62..6024bfa5b21 100644 --- a/vendor/github.com/minio/minio-go/v7/utils.go +++ b/vendor/github.com/minio/minio-go/v7/utils.go @@ -41,6 +41,7 @@ import ( md5simd "github.com/minio/md5-simd" "github.com/minio/minio-go/v7/pkg/s3utils" + "github.com/minio/minio-go/v7/pkg/tags" ) func trimEtag(etag string) string { @@ -322,7 +323,13 @@ func ToObjectInfo(bucketName, objectName string, h http.Header) (ObjectInfo, err userMetadata[strings.TrimPrefix(k, "X-Amz-Meta-")] = v[0] } } - userTags := s3utils.TagDecode(h.Get(amzTaggingHeader)) + + userTags, err := tags.ParseObjectTags(h.Get(amzTaggingHeader)) + if err != nil { + return ObjectInfo{}, ErrorResponse{ + Code: "InternalError", + } + } var tagCount int if count := h.Get(amzTaggingCount); count != "" { @@ -373,7 +380,7 @@ func ToObjectInfo(bucketName, objectName string, h http.Header) (ObjectInfo, err // which are not part of object metadata. Metadata: metadata, UserMetadata: userMetadata, - UserTags: userTags, + UserTags: userTags.ToMap(), UserTagCount: tagCount, Restore: restore, @@ -383,6 +390,7 @@ func ToObjectInfo(bucketName, objectName string, h http.Header) (ObjectInfo, err ChecksumSHA1: h.Get(ChecksumSHA1.Key()), ChecksumSHA256: h.Get(ChecksumSHA256.Key()), ChecksumCRC64NVME: h.Get(ChecksumCRC64NVME.Key()), + ChecksumMode: h.Get(ChecksumFullObjectMode.Key()), }, nil } diff --git a/vendor/github.com/opentracing-contrib/go-grpc/.golangci.yml b/vendor/github.com/opentracing-contrib/go-grpc/.golangci.yml index 30c2b21b02b..27a4e80bb0e 100644 --- a/vendor/github.com/opentracing-contrib/go-grpc/.golangci.yml +++ b/vendor/github.com/opentracing-contrib/go-grpc/.golangci.yml @@ -1,35 +1,6 @@ -linters-settings: - misspell: - locale: US - revive: - ignore-generated-header: true - rules: - - name: blank-imports - - name: context-as-argument - - name: context-keys-type - - name: dot-imports - - name: empty-block - - name: error-naming - - name: error-return - - name: error-strings - - name: errorf - - name: exported - - name: increment-decrement - - name: indent-error-flow - - name: package-comments - - name: range - - name: receiver-naming - - name: redefines-builtin-id - - name: superfluous-else - - name: time-naming - - name: unexported-return - - name: unreachable-code - - name: unused-parameter - - name: var-declaration - - name: var-naming - govet: - enable-all: true +version: "2" linters: + default: none enable: - asasalint - asciicheck @@ -48,11 +19,7 @@ linters: - gochecksumtype - gocritic - godot - - gofmt - - gofumpt - - goimports - gosec - - gosimple - gosmopolitan - govet - ineffassign @@ -70,22 +37,69 @@ linters: - reassign - revive - staticcheck - - stylecheck - tagalign - - tenv - thelper - tparallel - - typecheck - unconvert - unparam - unused - usestdlibvars - wastedassign - whitespace - # - wrapcheck - disable-all: true + - wrapcheck + settings: + govet: + enable-all: true + misspell: + locale: US + revive: + rules: + - name: blank-imports + - name: context-as-argument + - name: context-keys-type + - name: dot-imports + - name: empty-block + - name: error-naming + - name: error-return + - name: error-strings + - name: errorf + - name: exported + - name: increment-decrement + - name: indent-error-flow + - name: package-comments + - name: range + - name: receiver-naming + - name: redefines-builtin-id + - name: superfluous-else + - name: time-naming + - name: unexported-return + - name: unreachable-code + - name: unused-parameter + - name: var-declaration + - name: var-naming + exclusions: + generated: lax + presets: + - comments + - common-false-positives + - legacy + - std-error-handling + paths: + - third_party$ + - builtin$ + - examples$ issues: max-issues-per-linter: 0 max-same-issues: 0 -run: - timeout: 5m +formatters: + enable: + - gci + - gofmt + - gofumpt + - goimports + exclusions: + generated: lax + paths: + - third_party$ + - builtin$ + - examples$ diff --git a/vendor/github.com/opentracing-contrib/go-grpc/client.go b/vendor/github.com/opentracing-contrib/go-grpc/client.go index 2f7cdf7611e..b515feb7b11 100644 --- a/vendor/github.com/opentracing-contrib/go-grpc/client.go +++ b/vendor/github.com/opentracing-contrib/go-grpc/client.go @@ -3,6 +3,7 @@ package otgrpc import ( "context" "errors" + "fmt" "io" "runtime" "sync/atomic" @@ -193,39 +194,42 @@ func (cs *openTracingClientStream) Header() (metadata.MD, error) { md, err := cs.ClientStream.Header() if err != nil { cs.finishFunc(err) + return md, fmt.Errorf("failed to get header: %w", err) } - return md, err + return md, nil } func (cs *openTracingClientStream) SendMsg(m interface{}) error { err := cs.ClientStream.SendMsg(m) if err != nil { cs.finishFunc(err) + return fmt.Errorf("failed to send message: %w", err) } - return err + return nil } func (cs *openTracingClientStream) RecvMsg(m interface{}) error { err := cs.ClientStream.RecvMsg(m) if errors.Is(err, io.EOF) { cs.finishFunc(nil) - return err + return err //nolint:wrapcheck } else if err != nil { cs.finishFunc(err) - return err + return fmt.Errorf("failed to receive message: %w", err) } if !cs.desc.ServerStreams { cs.finishFunc(nil) } - return err + return nil } func (cs *openTracingClientStream) CloseSend() error { err := cs.ClientStream.CloseSend() if err != nil { cs.finishFunc(err) + return fmt.Errorf("failed to close send: %w", err) } - return err + return nil } func injectSpanContext(ctx context.Context, tracer opentracing.Tracer, clientSpan opentracing.Span) context.Context { diff --git a/vendor/github.com/opentracing-contrib/go-grpc/server.go b/vendor/github.com/opentracing-contrib/go-grpc/server.go index 71f7e1a8419..16416b5ae89 100644 --- a/vendor/github.com/opentracing-contrib/go-grpc/server.go +++ b/vendor/github.com/opentracing-contrib/go-grpc/server.go @@ -2,6 +2,7 @@ package otgrpc import ( "context" + "fmt" opentracing "github.com/opentracing/opentracing-go" "github.com/opentracing/opentracing-go/ext" @@ -138,5 +139,9 @@ func extractSpanContext(ctx context.Context, tracer opentracing.Tracer) (opentra if !ok { md = metadata.New(nil) } - return tracer.Extract(opentracing.HTTPHeaders, metadataReaderWriter{md}) + spanContext, err := tracer.Extract(opentracing.HTTPHeaders, metadataReaderWriter{md}) + if err != nil { + return nil, fmt.Errorf("failed to extract span context: %w", err) + } + return spanContext, nil } diff --git a/vendor/github.com/prometheus/client_golang/api/client.go b/vendor/github.com/prometheus/client_golang/api/client.go index afcf122efc5..ddbfea099ba 100644 --- a/vendor/github.com/prometheus/client_golang/api/client.go +++ b/vendor/github.com/prometheus/client_golang/api/client.go @@ -18,6 +18,7 @@ import ( "bytes" "context" "errors" + "io" "net" "net/http" "net/url" @@ -133,7 +134,8 @@ func (c *httpClient) Do(ctx context.Context, req *http.Request) (*http.Response, resp, err := c.client.Do(req) defer func() { if resp != nil { - resp.Body.Close() + _, _ = io.Copy(io.Discard, resp.Body) + _ = resp.Body.Close() } }() @@ -145,6 +147,7 @@ func (c *httpClient) Do(ctx context.Context, req *http.Request) (*http.Response, done := make(chan struct{}) go func() { var buf bytes.Buffer + // TODO(bwplotka): Add LimitReader for too long err messages (e.g. limit by 1KB) _, err = buf.ReadFrom(resp.Body) body = buf.Bytes() close(done) diff --git a/vendor/github.com/prometheus/client_golang/api/prometheus/v1/api.go b/vendor/github.com/prometheus/client_golang/api/prometheus/v1/api.go index cddf027fdae..8a72f9bfc7b 100644 --- a/vendor/github.com/prometheus/client_golang/api/prometheus/v1/api.go +++ b/vendor/github.com/prometheus/client_golang/api/prometheus/v1/api.go @@ -1076,9 +1076,19 @@ func (h *httpAPI) LabelValues(ctx context.Context, label string, matches []strin return labelValues, w, err } +// StatsValue is a type for `stats` query parameter. +type StatsValue string + +// AllStatsValue is the query parameter value to return all the query statistics. +const ( + AllStatsValue StatsValue = "all" +) + type apiOptions struct { - timeout time.Duration - limit uint64 + timeout time.Duration + lookbackDelta time.Duration + stats StatsValue + limit uint64 } type Option func(c *apiOptions) @@ -1091,6 +1101,24 @@ func WithTimeout(timeout time.Duration) Option { } } +// WithLookbackDelta can be used to provide an optional query lookback delta for Query and QueryRange. +// This URL variable is not documented on Prometheus HTTP API. +// https://github.com/prometheus/prometheus/blob/e04913aea2792a5c8bc7b3130c389ca1b027dd9b/promql/engine.go#L162-L167 +func WithLookbackDelta(lookbackDelta time.Duration) Option { + return func(o *apiOptions) { + o.lookbackDelta = lookbackDelta + } +} + +// WithStats can be used to provide an optional per step stats for Query and QueryRange. +// This URL variable is not documented on Prometheus HTTP API. +// https://github.com/prometheus/prometheus/blob/e04913aea2792a5c8bc7b3130c389ca1b027dd9b/promql/engine.go#L162-L167 +func WithStats(stats StatsValue) Option { + return func(o *apiOptions) { + o.stats = stats + } +} + // WithLimit provides an optional maximum number of returned entries for APIs that support limit parameter // e.g. https://prometheus.io/docs/prometheus/latest/querying/api/#instant-querie:~:text=%3A%20End%20timestamp.-,limit%3D%3Cnumber%3E,-%3A%20Maximum%20number%20of func WithLimit(limit uint64) Option { @@ -1109,6 +1137,14 @@ func addOptionalURLParams(q url.Values, opts []Option) url.Values { q.Set("timeout", opt.timeout.String()) } + if opt.lookbackDelta > 0 { + q.Set("lookback_delta", opt.lookbackDelta.String()) + } + + if opt.stats != "" { + q.Set("stats", string(opt.stats)) + } + if opt.limit > 0 { q.Set("limit", strconv.FormatUint(opt.limit, 10)) } diff --git a/vendor/github.com/prometheus/client_golang/prometheus/collectorfunc.go b/vendor/github.com/prometheus/client_golang/prometheus/collectorfunc.go new file mode 100644 index 00000000000..9a71a15db1d --- /dev/null +++ b/vendor/github.com/prometheus/client_golang/prometheus/collectorfunc.go @@ -0,0 +1,30 @@ +// Copyright 2025 The Prometheus Authors +// Licensed under the Apache License, Version 2.0 (the "License"); +// you may not use this file except in compliance with the License. +// You may obtain a copy of the License at +// +// http://www.apache.org/licenses/LICENSE-2.0 +// +// Unless required by applicable law or agreed to in writing, software +// distributed under the License is distributed on an "AS IS" BASIS, +// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. +// See the License for the specific language governing permissions and +// limitations under the License. + +package prometheus + +// CollectorFunc is a convenient way to implement a Prometheus Collector +// without interface boilerplate. +// This implementation is based on DescribeByCollect method. +// familiarize yourself to it before using. +type CollectorFunc func(chan<- Metric) + +// Collect calls the defined CollectorFunc function with the provided Metrics channel +func (f CollectorFunc) Collect(ch chan<- Metric) { + f(ch) +} + +// Describe sends the descriptor information using DescribeByCollect +func (f CollectorFunc) Describe(ch chan<- *Desc) { + DescribeByCollect(f, ch) +} diff --git a/vendor/github.com/prometheus/client_golang/prometheus/promhttp/http.go b/vendor/github.com/prometheus/client_golang/prometheus/promhttp/http.go index 28eed26727a..763d99e3623 100644 --- a/vendor/github.com/prometheus/client_golang/prometheus/promhttp/http.go +++ b/vendor/github.com/prometheus/client_golang/prometheus/promhttp/http.go @@ -41,11 +41,11 @@ import ( "sync" "time" - "github.com/klauspost/compress/zstd" "github.com/prometheus/common/expfmt" "github.com/prometheus/client_golang/internal/github.com/golang/gddo/httputil" "github.com/prometheus/client_golang/prometheus" + "github.com/prometheus/client_golang/prometheus/promhttp/internal" ) const ( @@ -65,7 +65,13 @@ const ( Zstd Compression = "zstd" ) -var defaultCompressionFormats = []Compression{Identity, Gzip, Zstd} +func defaultCompressionFormats() []Compression { + if internal.NewZstdWriter != nil { + return []Compression{Identity, Gzip, Zstd} + } else { + return []Compression{Identity, Gzip} + } +} var gzipPool = sync.Pool{ New: func() interface{} { @@ -138,7 +144,7 @@ func HandlerForTransactional(reg prometheus.TransactionalGatherer, opts HandlerO // Select compression formats to offer based on default or user choice. var compressions []string if !opts.DisableCompression { - offers := defaultCompressionFormats + offers := defaultCompressionFormats() if len(opts.OfferedCompressions) > 0 { offers = opts.OfferedCompressions } @@ -466,14 +472,12 @@ func negotiateEncodingWriter(r *http.Request, rw io.Writer, compressions []strin switch selected { case "zstd": - // TODO(mrueg): Replace klauspost/compress with stdlib implementation once https://github.com/golang/go/issues/62513 is implemented. - z, err := zstd.NewWriter(rw, zstd.WithEncoderLevel(zstd.SpeedFastest)) - if err != nil { - return nil, "", func() {}, err + if internal.NewZstdWriter == nil { + // The content encoding was not implemented yet. + return nil, "", func() {}, fmt.Errorf("content compression format not recognized: %s. Valid formats are: %s", selected, defaultCompressionFormats()) } - - z.Reset(rw) - return z, selected, func() { _ = z.Close() }, nil + writer, closeWriter, err := internal.NewZstdWriter(rw) + return writer, selected, closeWriter, err case "gzip": gz := gzipPool.Get().(*gzip.Writer) gz.Reset(rw) @@ -483,6 +487,6 @@ func negotiateEncodingWriter(r *http.Request, rw io.Writer, compressions []strin return rw, selected, func() {}, nil default: // The content encoding was not implemented yet. - return nil, "", func() {}, fmt.Errorf("content compression format not recognized: %s. Valid formats are: %s", selected, defaultCompressionFormats) + return nil, "", func() {}, fmt.Errorf("content compression format not recognized: %s. Valid formats are: %s", selected, defaultCompressionFormats()) } } diff --git a/vendor/github.com/prometheus/client_golang/prometheus/promhttp/internal/compression.go b/vendor/github.com/prometheus/client_golang/prometheus/promhttp/internal/compression.go new file mode 100644 index 00000000000..c5039590f77 --- /dev/null +++ b/vendor/github.com/prometheus/client_golang/prometheus/promhttp/internal/compression.go @@ -0,0 +1,21 @@ +// Copyright 2025 The Prometheus Authors +// Licensed under the Apache License, Version 2.0 (the "License"); +// you may not use this file except in compliance with the License. +// You may obtain a copy of the License at +// +// http://www.apache.org/licenses/LICENSE-2.0 +// +// Unless required by applicable law or agreed to in writing, software +// distributed under the License is distributed on an "AS IS" BASIS, +// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. +// See the License for the specific language governing permissions and +// limitations under the License. + +package internal + +import ( + "io" +) + +// NewZstdWriter enables zstd write support if non-nil. +var NewZstdWriter func(rw io.Writer) (_ io.Writer, closeWriter func(), _ error) diff --git a/vendor/github.com/prometheus/common/config/headers.go b/vendor/github.com/prometheus/common/config/headers.go index 7276742ec90..9beaae26c20 100644 --- a/vendor/github.com/prometheus/common/config/headers.go +++ b/vendor/github.com/prometheus/common/config/headers.go @@ -24,9 +24,9 @@ import ( "strings" ) -// reservedHeaders that change the connection, are set by Prometheus, or can +// ReservedHeaders that change the connection, are set by Prometheus, or can // be changed otherwise. -var reservedHeaders = map[string]struct{}{ +var ReservedHeaders = map[string]struct{}{ "Authorization": {}, "Host": {}, "Content-Encoding": {}, @@ -72,7 +72,7 @@ func (h *Headers) SetDirectory(dir string) { // Validate validates the Headers config. func (h *Headers) Validate() error { for n := range h.Headers { - if _, ok := reservedHeaders[http.CanonicalHeaderKey(n)]; ok { + if _, ok := ReservedHeaders[http.CanonicalHeaderKey(n)]; ok { return fmt.Errorf("setting header %q is not allowed", http.CanonicalHeaderKey(n)) } } diff --git a/vendor/github.com/prometheus/common/model/alert.go b/vendor/github.com/prometheus/common/model/alert.go index bd3a39e3e14..460f554f294 100644 --- a/vendor/github.com/prometheus/common/model/alert.go +++ b/vendor/github.com/prometheus/common/model/alert.go @@ -65,7 +65,7 @@ func (a *Alert) Resolved() bool { return a.ResolvedAt(time.Now()) } -// ResolvedAt returns true off the activity interval ended before +// ResolvedAt returns true iff the activity interval ended before // the given timestamp. func (a *Alert) ResolvedAt(ts time.Time) bool { if a.EndsAt.IsZero() { diff --git a/vendor/github.com/prometheus/common/model/labels.go b/vendor/github.com/prometheus/common/model/labels.go index 73b7aa3e60b..f4a387605f1 100644 --- a/vendor/github.com/prometheus/common/model/labels.go +++ b/vendor/github.com/prometheus/common/model/labels.go @@ -22,7 +22,7 @@ import ( ) const ( - // AlertNameLabel is the name of the label containing the an alert's name. + // AlertNameLabel is the name of the label containing the alert's name. AlertNameLabel = "alertname" // ExportedLabelPrefix is the prefix to prepend to the label names present in diff --git a/vendor/github.com/prometheus/common/model/metric.go b/vendor/github.com/prometheus/common/model/metric.go index 5766107cf95..a6b01755bd4 100644 --- a/vendor/github.com/prometheus/common/model/metric.go +++ b/vendor/github.com/prometheus/common/model/metric.go @@ -27,13 +27,25 @@ import ( ) var ( - // NameValidationScheme determines the method of name validation to be used by - // all calls to IsValidMetricName() and LabelName IsValid(). Setting UTF-8 - // mode in isolation from other components that don't support UTF-8 may result - // in bugs or other undefined behavior. This value can be set to - // LegacyValidation during startup if a binary is not UTF-8-aware binaries. To - // avoid need for locking, this value should be set once, ideally in an - // init(), before multiple goroutines are started. + // NameValidationScheme determines the global default method of the name + // validation to be used by all calls to IsValidMetricName() and LabelName + // IsValid(). + // + // Deprecated: This variable should not be used and might be removed in the + // far future. If you wish to stick to the legacy name validation use + // `IsValidLegacyMetricName()` and `LabelName.IsValidLegacy()` methods + // instead. This variable is here as an escape hatch for emergency cases, + // given the recent change from `LegacyValidation` to `UTF8Validation`, e.g., + // to delay UTF-8 migrations in time or aid in debugging unforeseen results of + // the change. In such a case, a temporary assignment to `LegacyValidation` + // value in the `init()` function in your main.go or so, could be considered. + // + // Historically we opted for a global variable for feature gating different + // validation schemes in operations that were not otherwise easily adjustable + // (e.g. Labels yaml unmarshaling). That could have been a mistake, a separate + // Labels structure or package might have been a better choice. Given the + // change was made and many upgraded the common already, we live this as-is + // with this warning and learning for the future. NameValidationScheme = UTF8Validation // NameEscapingScheme defines the default way that names will be escaped when @@ -50,7 +62,7 @@ var ( type ValidationScheme int const ( - // LegacyValidation is a setting that requirets that metric and label names + // LegacyValidation is a setting that requires that all metric and label names // conform to the original Prometheus character requirements described by // MetricNameRE and LabelNameRE. LegacyValidation ValidationScheme = iota diff --git a/vendor/github.com/prometheus/common/promslog/slog.go b/vendor/github.com/prometheus/common/promslog/slog.go index 6e8fbabce5d..f9f89966315 100644 --- a/vendor/github.com/prometheus/common/promslog/slog.go +++ b/vendor/github.com/prometheus/common/promslog/slog.go @@ -25,73 +25,43 @@ import ( "path/filepath" "strconv" "strings" + "time" ) +// LogStyle represents the common logging formats in the Prometheus ecosystem. type LogStyle string const ( SlogStyle LogStyle = "slog" GoKitStyle LogStyle = "go-kit" + + reservedKeyPrefix = "logged_" ) var ( - LevelFlagOptions = []string{"debug", "info", "warn", "error"} + // LevelFlagOptions represents allowed logging levels. + LevelFlagOptions = []string{"debug", "info", "warn", "error"} + // FormatFlagOptions represents allowed formats. FormatFlagOptions = []string{"logfmt", "json"} - callerAddFunc = false - defaultWriter = os.Stderr - goKitStyleReplaceAttrFunc = func(groups []string, a slog.Attr) slog.Attr { - key := a.Key - switch key { - case slog.TimeKey: - a.Key = "ts" - - // This timestamp format differs from RFC3339Nano by using .000 instead - // of .999999999 which changes the timestamp from 9 variable to 3 fixed - // decimals (.130 instead of .130987456). - t := a.Value.Time() - a.Value = slog.StringValue(t.UTC().Format("2006-01-02T15:04:05.000Z07:00")) - case slog.SourceKey: - a.Key = "caller" - src, _ := a.Value.Any().(*slog.Source) - - switch callerAddFunc { - case true: - a.Value = slog.StringValue(filepath.Base(src.File) + "(" + filepath.Base(src.Function) + "):" + strconv.Itoa(src.Line)) - default: - a.Value = slog.StringValue(filepath.Base(src.File) + ":" + strconv.Itoa(src.Line)) - } - case slog.LevelKey: - a.Value = slog.StringValue(strings.ToLower(a.Value.String())) - default: - } - - return a - } - defaultReplaceAttrFunc = func(groups []string, a slog.Attr) slog.Attr { - key := a.Key - switch key { - case slog.TimeKey: - t := a.Value.Time() - a.Value = slog.TimeValue(t.UTC()) - case slog.SourceKey: - src, _ := a.Value.Any().(*slog.Source) - a.Value = slog.StringValue(filepath.Base(src.File) + ":" + strconv.Itoa(src.Line)) - default: - } - - return a - } + defaultWriter = os.Stderr ) -// AllowedLevel is a settable identifier for the minimum level a log entry -// must be have. -type AllowedLevel struct { - s string +// Level controls a logging level, with an info default. +// It wraps slog.LevelVar with string-based level control. +// Level is safe to be used concurrently. +type Level struct { lvl *slog.LevelVar } -func (l *AllowedLevel) UnmarshalYAML(unmarshal func(interface{}) error) error { +// NewLevel returns a new Level. +func NewLevel() *Level { + return &Level{ + lvl: &slog.LevelVar{}, + } +} + +func (l *Level) UnmarshalYAML(unmarshal func(interface{}) error) error { var s string type plain string if err := unmarshal((*plain)(&s)); err != nil { @@ -100,55 +70,60 @@ func (l *AllowedLevel) UnmarshalYAML(unmarshal func(interface{}) error) error { if s == "" { return nil } - lo := &AllowedLevel{} - if err := lo.Set(s); err != nil { + if err := l.Set(s); err != nil { return err } - *l = *lo return nil } -func (l *AllowedLevel) String() string { - return l.s -} - -// Set updates the value of the allowed level. -func (l *AllowedLevel) Set(s string) error { - if l.lvl == nil { - l.lvl = &slog.LevelVar{} +// String returns the current level. +func (l *Level) String() string { + switch l.lvl.Level() { + case slog.LevelDebug: + return "debug" + case slog.LevelInfo: + return "info" + case slog.LevelWarn: + return "warn" + case slog.LevelError: + return "error" + default: + return "" } +} +// Set updates the logging level with the validation. +func (l *Level) Set(s string) error { switch strings.ToLower(s) { case "debug": l.lvl.Set(slog.LevelDebug) - callerAddFunc = true case "info": l.lvl.Set(slog.LevelInfo) - callerAddFunc = false case "warn": l.lvl.Set(slog.LevelWarn) - callerAddFunc = false case "error": l.lvl.Set(slog.LevelError) - callerAddFunc = false default: return fmt.Errorf("unrecognized log level %s", s) } - l.s = s return nil } -// AllowedFormat is a settable identifier for the output format that the logger can have. -type AllowedFormat struct { +// Format controls a logging output format. +// Not concurrency-safe. +type Format struct { s string } -func (f *AllowedFormat) String() string { +// NewFormat creates a new Format. +func NewFormat() *Format { return &Format{} } + +func (f *Format) String() string { return f.s } // Set updates the value of the allowed format. -func (f *AllowedFormat) Set(s string) error { +func (f *Format) Set(s string) error { switch s { case "logfmt", "json": f.s = s @@ -160,18 +135,113 @@ func (f *AllowedFormat) Set(s string) error { // Config is a struct containing configurable settings for the logger type Config struct { - Level *AllowedLevel - Format *AllowedFormat + Level *Level + Format *Format Style LogStyle Writer io.Writer } +func newGoKitStyleReplaceAttrFunc(lvl *Level) func(groups []string, a slog.Attr) slog.Attr { + return func(groups []string, a slog.Attr) slog.Attr { + key := a.Key + switch key { + case slog.TimeKey, "ts": + if t, ok := a.Value.Any().(time.Time); ok { + a.Key = "ts" + + // This timestamp format differs from RFC3339Nano by using .000 instead + // of .999999999 which changes the timestamp from 9 variable to 3 fixed + // decimals (.130 instead of .130987456). + a.Value = slog.StringValue(t.UTC().Format("2006-01-02T15:04:05.000Z07:00")) + } else { + // If we can't cast the any from the value to a + // time.Time, it means the caller logged + // another attribute with a key of `ts`. + // Prevent duplicate keys (necessary for proper + // JSON) by renaming the key to `logged_ts`. + a.Key = reservedKeyPrefix + key + } + case slog.SourceKey, "caller": + if src, ok := a.Value.Any().(*slog.Source); ok { + a.Key = "caller" + switch lvl.String() { + case "debug": + a.Value = slog.StringValue(filepath.Base(src.File) + "(" + filepath.Base(src.Function) + "):" + strconv.Itoa(src.Line)) + default: + a.Value = slog.StringValue(filepath.Base(src.File) + ":" + strconv.Itoa(src.Line)) + } + } else { + // If we can't cast the any from the value to + // an *slog.Source, it means the caller logged + // another attribute with a key of `caller`. + // Prevent duplicate keys (necessary for proper + // JSON) by renaming the key to + // `logged_caller`. + a.Key = reservedKeyPrefix + key + } + case slog.LevelKey: + if lvl, ok := a.Value.Any().(slog.Level); ok { + a.Value = slog.StringValue(strings.ToLower(lvl.String())) + } else { + // If we can't cast the any from the value to + // an slog.Level, it means the caller logged + // another attribute with a key of `level`. + // Prevent duplicate keys (necessary for proper + // JSON) by renaming the key to `logged_level`. + a.Key = reservedKeyPrefix + key + } + default: + } + return a + } +} + +func defaultReplaceAttr(_ []string, a slog.Attr) slog.Attr { + key := a.Key + switch key { + case slog.TimeKey: + if t, ok := a.Value.Any().(time.Time); ok { + a.Value = slog.TimeValue(t.UTC()) + } else { + // If we can't cast the any from the value to a + // time.Time, it means the caller logged + // another attribute with a key of `time`. + // Prevent duplicate keys (necessary for proper + // JSON) by renaming the key to `logged_time`. + a.Key = reservedKeyPrefix + key + } + case slog.SourceKey: + if src, ok := a.Value.Any().(*slog.Source); ok { + a.Value = slog.StringValue(filepath.Base(src.File) + ":" + strconv.Itoa(src.Line)) + } else { + // If we can't cast the any from the value to + // an *slog.Source, it means the caller logged + // another attribute with a key of `source`. + // Prevent duplicate keys (necessary for proper + // JSON) by renaming the key to + // `logged_source`. + a.Key = reservedKeyPrefix + key + } + case slog.LevelKey: + if _, ok := a.Value.Any().(slog.Level); !ok { + // If we can't cast the any from the value to + // an slog.Level, it means the caller logged + // another attribute with a key of `level`. + // Prevent duplicate keys (necessary for proper + // JSON) by renaming the key to + // `logged_level`. + a.Key = reservedKeyPrefix + key + } + default: + } + return a +} + // New returns a new slog.Logger. Each logged line will be annotated // with a timestamp. The output always goes to stderr. func New(config *Config) *slog.Logger { if config.Level == nil { - config.Level = &AllowedLevel{} - _ = config.Level.Set("info") + config.Level = NewLevel() } if config.Writer == nil { @@ -181,11 +251,11 @@ func New(config *Config) *slog.Logger { logHandlerOpts := &slog.HandlerOptions{ Level: config.Level.lvl, AddSource: true, - ReplaceAttr: defaultReplaceAttrFunc, + ReplaceAttr: defaultReplaceAttr, } if config.Style == GoKitStyle { - logHandlerOpts.ReplaceAttr = goKitStyleReplaceAttrFunc + logHandlerOpts.ReplaceAttr = newGoKitStyleReplaceAttrFunc(config.Level) } if config.Format != nil && config.Format.s == "json" { diff --git a/vendor/github.com/prometheus/procfs/.golangci.yml b/vendor/github.com/prometheus/procfs/.golangci.yml index 126df9e67ac..3c3bf910fdf 100644 --- a/vendor/github.com/prometheus/procfs/.golangci.yml +++ b/vendor/github.com/prometheus/procfs/.golangci.yml @@ -1,22 +1,45 @@ ---- +version: "2" linters: enable: - - errcheck - - godot - - gosimple - - govet - - ineffassign - - misspell - - revive - - staticcheck - - testifylint - - unused - -linter-settings: - godot: - capital: true - exclude: - # Ignore "See: URL" - - 'See:' - misspell: - locale: US + - forbidigo + - godot + - misspell + - revive + - testifylint + settings: + forbidigo: + forbid: + - pattern: ^fmt\.Print.*$ + msg: Do not commit print statements. + godot: + exclude: + # Ignore "See: URL". + - 'See:' + capital: true + misspell: + locale: US + exclusions: + generated: lax + presets: + - comments + - common-false-positives + - legacy + - std-error-handling + paths: + - third_party$ + - builtin$ + - examples$ +formatters: + enable: + - gofmt + - goimports + settings: + goimports: + local-prefixes: + - github.com/prometheus/procfs + exclusions: + generated: lax + paths: + - third_party$ + - builtin$ + - examples$ diff --git a/vendor/github.com/prometheus/procfs/Makefile.common b/vendor/github.com/prometheus/procfs/Makefile.common index 16172923506..0ed55c2ba21 100644 --- a/vendor/github.com/prometheus/procfs/Makefile.common +++ b/vendor/github.com/prometheus/procfs/Makefile.common @@ -33,7 +33,7 @@ GOHOSTOS ?= $(shell $(GO) env GOHOSTOS) GOHOSTARCH ?= $(shell $(GO) env GOHOSTARCH) GO_VERSION ?= $(shell $(GO) version) -GO_VERSION_NUMBER ?= $(word 3, $(GO_VERSION)) +GO_VERSION_NUMBER ?= $(word 3, $(GO_VERSION))Error Parsing File PRE_GO_111 ?= $(shell echo $(GO_VERSION_NUMBER) | grep -E 'go1\.(10|[0-9])\.') PROMU := $(FIRST_GOPATH)/bin/promu @@ -61,7 +61,7 @@ PROMU_URL := https://github.com/prometheus/promu/releases/download/v$(PROMU_ SKIP_GOLANGCI_LINT := GOLANGCI_LINT := GOLANGCI_LINT_OPTS ?= -GOLANGCI_LINT_VERSION ?= v1.59.0 +GOLANGCI_LINT_VERSION ?= v2.0.2 # golangci-lint only supports linux, darwin and windows platforms on i386/amd64/arm64. # windows isn't included here because of the path separator being different. ifeq ($(GOHOSTOS),$(filter $(GOHOSTOS),linux darwin)) @@ -275,3 +275,9 @@ $(1)_precheck: exit 1; \ fi endef + +govulncheck: install-govulncheck + govulncheck ./... + +install-govulncheck: + command -v govulncheck > /dev/null || go install golang.org/x/vuln/cmd/govulncheck@latest diff --git a/vendor/github.com/prometheus/procfs/README.md b/vendor/github.com/prometheus/procfs/README.md index 1224816c2ad..0718239cf19 100644 --- a/vendor/github.com/prometheus/procfs/README.md +++ b/vendor/github.com/prometheus/procfs/README.md @@ -47,15 +47,15 @@ However, most of the API includes unit tests which can be run with `make test`. The procfs library includes a set of test fixtures which include many example files from the `/proc` and `/sys` filesystems. These fixtures are included as a [ttar](https://github.com/ideaship/ttar) file which is extracted automatically during testing. To add/update the test fixtures, first -ensure the `fixtures` directory is up to date by removing the existing directory and then -extracting the ttar file using `make fixtures/.unpacked` or just `make test`. +ensure the `testdata/fixtures` directory is up to date by removing the existing directory and then +extracting the ttar file using `make testdata/fixtures/.unpacked` or just `make test`. ```bash rm -rf testdata/fixtures make test ``` -Next, make the required changes to the extracted files in the `fixtures` directory. When +Next, make the required changes to the extracted files in the `testdata/fixtures` directory. When the changes are complete, run `make update_fixtures` to create a new `fixtures.ttar` file based on the updated `fixtures` directory. And finally, verify the changes using `git diff testdata/fixtures.ttar`. diff --git a/vendor/github.com/prometheus/procfs/arp.go b/vendor/github.com/prometheus/procfs/arp.go index cdcc8a7ccc4..2e53344151f 100644 --- a/vendor/github.com/prometheus/procfs/arp.go +++ b/vendor/github.com/prometheus/procfs/arp.go @@ -23,9 +23,9 @@ import ( // Learned from include/uapi/linux/if_arp.h. const ( - // completed entry (ha valid). + // Completed entry (ha valid). ATFComplete = 0x02 - // permanent entry. + // Permanent entry. ATFPermanent = 0x04 // Publish entry. ATFPublish = 0x08 diff --git a/vendor/github.com/prometheus/procfs/fs.go b/vendor/github.com/prometheus/procfs/fs.go index 4980c875bfc..9bdaccc7c8a 100644 --- a/vendor/github.com/prometheus/procfs/fs.go +++ b/vendor/github.com/prometheus/procfs/fs.go @@ -24,8 +24,14 @@ type FS struct { isReal bool } -// DefaultMountPoint is the common mount point of the proc filesystem. -const DefaultMountPoint = fs.DefaultProcMountPoint +const ( + // DefaultMountPoint is the common mount point of the proc filesystem. + DefaultMountPoint = fs.DefaultProcMountPoint + + // SectorSize represents the size of a sector in bytes. + // It is specific to Linux block I/O operations. + SectorSize = 512 +) // NewDefaultFS returns a new proc FS mounted under the default proc mountPoint. // It will error if the mount point directory can't be read or is a file. diff --git a/vendor/github.com/prometheus/procfs/fs_statfs_notype.go b/vendor/github.com/prometheus/procfs/fs_statfs_notype.go index 134767d69ac..1b5bdbdf84a 100644 --- a/vendor/github.com/prometheus/procfs/fs_statfs_notype.go +++ b/vendor/github.com/prometheus/procfs/fs_statfs_notype.go @@ -17,7 +17,7 @@ package procfs // isRealProc returns true on architectures that don't have a Type argument -// in their Statfs_t struct -func isRealProc(mountPoint string) (bool, error) { +// in their Statfs_t struct. +func isRealProc(_ string) (bool, error) { return true, nil } diff --git a/vendor/github.com/prometheus/procfs/fscache.go b/vendor/github.com/prometheus/procfs/fscache.go index cf2e3eaa03c..7db86330779 100644 --- a/vendor/github.com/prometheus/procfs/fscache.go +++ b/vendor/github.com/prometheus/procfs/fscache.go @@ -162,7 +162,7 @@ type Fscacheinfo struct { ReleaseRequestsAgainstPagesStoredByTimeLockGranted uint64 // Number of release reqs ignored due to in-progress store ReleaseRequestsIgnoredDueToInProgressStore uint64 - // Number of page stores cancelled due to release req + // Number of page stores canceled due to release req PageStoresCancelledByReleaseRequests uint64 VmscanWaiting uint64 // Number of times async ops added to pending queues @@ -171,11 +171,11 @@ type Fscacheinfo struct { OpsRunning uint64 // Number of times async ops queued for processing OpsEnqueued uint64 - // Number of async ops cancelled + // Number of async ops canceled OpsCancelled uint64 // Number of async ops rejected due to object lookup/create failure OpsRejected uint64 - // Number of async ops initialised + // Number of async ops initialized OpsInitialised uint64 // Number of async ops queued for deferred release OpsDeferred uint64 diff --git a/vendor/github.com/prometheus/procfs/internal/fs/fs.go b/vendor/github.com/prometheus/procfs/internal/fs/fs.go index 3c18c7610ef..3a43e83915f 100644 --- a/vendor/github.com/prometheus/procfs/internal/fs/fs.go +++ b/vendor/github.com/prometheus/procfs/internal/fs/fs.go @@ -28,6 +28,9 @@ const ( // DefaultConfigfsMountPoint is the common mount point of the configfs. DefaultConfigfsMountPoint = "/sys/kernel/config" + + // DefaultSelinuxMountPoint is the common mount point of the selinuxfs. + DefaultSelinuxMountPoint = "/sys/fs/selinux" ) // FS represents a pseudo-filesystem, normally /proc or /sys, which provides an diff --git a/vendor/github.com/prometheus/procfs/internal/util/parse.go b/vendor/github.com/prometheus/procfs/internal/util/parse.go index 14272dc7885..5a7d2df06ae 100644 --- a/vendor/github.com/prometheus/procfs/internal/util/parse.go +++ b/vendor/github.com/prometheus/procfs/internal/util/parse.go @@ -14,6 +14,7 @@ package util import ( + "errors" "os" "strconv" "strings" @@ -110,3 +111,16 @@ func ParseBool(b string) *bool { } return &truth } + +// ReadHexFromFile reads a file and attempts to parse a uint64 from a hexadecimal format 0xXX. +func ReadHexFromFile(path string) (uint64, error) { + data, err := os.ReadFile(path) + if err != nil { + return 0, err + } + hexString := strings.TrimSpace(string(data)) + if !strings.HasPrefix(hexString, "0x") { + return 0, errors.New("invalid format: hex string does not start with '0x'") + } + return strconv.ParseUint(hexString[2:], 16, 64) +} diff --git a/vendor/github.com/prometheus/procfs/internal/util/sysreadfile.go b/vendor/github.com/prometheus/procfs/internal/util/sysreadfile.go index 1ab875ceec6..d5404a6d728 100644 --- a/vendor/github.com/prometheus/procfs/internal/util/sysreadfile.go +++ b/vendor/github.com/prometheus/procfs/internal/util/sysreadfile.go @@ -20,6 +20,8 @@ package util import ( "bytes" "os" + "strconv" + "strings" "syscall" ) @@ -48,3 +50,21 @@ func SysReadFile(file string) (string, error) { return string(bytes.TrimSpace(b[:n])), nil } + +// SysReadUintFromFile reads a file using SysReadFile and attempts to parse a uint64 from it. +func SysReadUintFromFile(path string) (uint64, error) { + data, err := SysReadFile(path) + if err != nil { + return 0, err + } + return strconv.ParseUint(strings.TrimSpace(string(data)), 10, 64) +} + +// SysReadIntFromFile reads a file using SysReadFile and attempts to parse a int64 from it. +func SysReadIntFromFile(path string) (int64, error) { + data, err := SysReadFile(path) + if err != nil { + return 0, err + } + return strconv.ParseInt(strings.TrimSpace(string(data)), 10, 64) +} diff --git a/vendor/github.com/prometheus/procfs/mountstats.go b/vendor/github.com/prometheus/procfs/mountstats.go index 75a3b6c810f..50caa73274e 100644 --- a/vendor/github.com/prometheus/procfs/mountstats.go +++ b/vendor/github.com/prometheus/procfs/mountstats.go @@ -45,11 +45,11 @@ const ( fieldTransport11TCPLen = 13 fieldTransport11UDPLen = 10 - // kernel version >= 4.14 MaxLen + // Kernel version >= 4.14 MaxLen // See: https://elixir.bootlin.com/linux/v6.4.8/source/net/sunrpc/xprtrdma/xprt_rdma.h#L393 fieldTransport11RDMAMaxLen = 28 - // kernel version <= 4.2 MinLen + // Kernel version <= 4.2 MinLen // See: https://elixir.bootlin.com/linux/v4.2.8/source/net/sunrpc/xprtrdma/xprt_rdma.h#L331 fieldTransport11RDMAMinLen = 20 ) @@ -601,11 +601,12 @@ func parseNFSTransportStats(ss []string, statVersion string) (*NFSTransportStats switch statVersion { case statVersion10: var expectedLength int - if protocol == "tcp" { + switch protocol { + case "tcp": expectedLength = fieldTransport10TCPLen - } else if protocol == "udp" { + case "udp": expectedLength = fieldTransport10UDPLen - } else { + default: return nil, fmt.Errorf("%w: Invalid NFS protocol \"%s\" in stats 1.0 statement: %v", ErrFileParse, protocol, ss) } if len(ss) != expectedLength { @@ -613,13 +614,14 @@ func parseNFSTransportStats(ss []string, statVersion string) (*NFSTransportStats } case statVersion11: var expectedLength int - if protocol == "tcp" { + switch protocol { + case "tcp": expectedLength = fieldTransport11TCPLen - } else if protocol == "udp" { + case "udp": expectedLength = fieldTransport11UDPLen - } else if protocol == "rdma" { + case "rdma": expectedLength = fieldTransport11RDMAMinLen - } else { + default: return nil, fmt.Errorf("%w: invalid NFS protocol \"%s\" in stats 1.1 statement: %v", ErrFileParse, protocol, ss) } if (len(ss) != expectedLength && (protocol == "tcp" || protocol == "udp")) || @@ -655,11 +657,12 @@ func parseNFSTransportStats(ss []string, statVersion string) (*NFSTransportStats // For the udp RPC transport there is no connection count, connect idle time, // or idle time (fields #3, #4, and #5); all other fields are the same. So // we set them to 0 here. - if protocol == "udp" { + switch protocol { + case "udp": ns = append(ns[:2], append(make([]uint64, 3), ns[2:]...)...) - } else if protocol == "tcp" { + case "tcp": ns = append(ns[:fieldTransport11TCPLen], make([]uint64, fieldTransport11RDMAMaxLen-fieldTransport11TCPLen+3)...) - } else if protocol == "rdma" { + case "rdma": ns = append(ns[:fieldTransport10TCPLen], append(make([]uint64, 3), ns[fieldTransport10TCPLen:]...)...) } diff --git a/vendor/github.com/prometheus/procfs/net_dev_snmp6.go b/vendor/github.com/prometheus/procfs/net_dev_snmp6.go new file mode 100644 index 00000000000..f50b38e3528 --- /dev/null +++ b/vendor/github.com/prometheus/procfs/net_dev_snmp6.go @@ -0,0 +1,96 @@ +// Copyright 2018 The Prometheus Authors +// Licensed under the Apache License, Version 2.0 (the "License"); +// you may not use this file except in compliance with the License. +// You may obtain a copy of the License at +// +// http://www.apache.org/licenses/LICENSE-2.0 +// +// Unless required by applicable law or agreed to in writing, software +// distributed under the License is distributed on an "AS IS" BASIS, +// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. +// See the License for the specific language governing permissions and +// limitations under the License. + +package procfs + +import ( + "bufio" + "errors" + "io" + "os" + "strconv" + "strings" +) + +// NetDevSNMP6 is parsed from files in /proc/net/dev_snmp6/ or /proc//net/dev_snmp6/. +// The outer map's keys are interface names and the inner map's keys are stat names. +// +// If you'd like a total across all interfaces, please use the Snmp6() method of the Proc type. +type NetDevSNMP6 map[string]map[string]uint64 + +// Returns kernel/system statistics read from interface files within the /proc/net/dev_snmp6/ +// directory. +func (fs FS) NetDevSNMP6() (NetDevSNMP6, error) { + return newNetDevSNMP6(fs.proc.Path("net/dev_snmp6")) +} + +// Returns kernel/system statistics read from interface files within the /proc//net/dev_snmp6/ +// directory. +func (p Proc) NetDevSNMP6() (NetDevSNMP6, error) { + return newNetDevSNMP6(p.path("net/dev_snmp6")) +} + +// newNetDevSNMP6 creates a new NetDevSNMP6 from the contents of the given directory. +func newNetDevSNMP6(dir string) (NetDevSNMP6, error) { + netDevSNMP6 := make(NetDevSNMP6) + + // The net/dev_snmp6 folders contain one file per interface + ifaceFiles, err := os.ReadDir(dir) + if err != nil { + // On systems with IPv6 disabled, this directory won't exist. + // Do nothing. + if errors.Is(err, os.ErrNotExist) { + return netDevSNMP6, err + } + return netDevSNMP6, err + } + + for _, iFaceFile := range ifaceFiles { + f, err := os.Open(dir + "/" + iFaceFile.Name()) + if err != nil { + return netDevSNMP6, err + } + defer f.Close() + + netDevSNMP6[iFaceFile.Name()], err = parseNetDevSNMP6Stats(f) + if err != nil { + return netDevSNMP6, err + } + } + + return netDevSNMP6, nil +} + +func parseNetDevSNMP6Stats(r io.Reader) (map[string]uint64, error) { + m := make(map[string]uint64) + + scanner := bufio.NewScanner(r) + for scanner.Scan() { + stat := strings.Fields(scanner.Text()) + if len(stat) < 2 { + continue + } + key, val := stat[0], stat[1] + + // Expect stat name to contain "6" or be "ifIndex" + if strings.Contains(key, "6") || key == "ifIndex" { + v, err := strconv.ParseUint(val, 10, 64) + if err != nil { + return m, err + } + + m[key] = v + } + } + return m, scanner.Err() +} diff --git a/vendor/github.com/prometheus/procfs/net_ip_socket.go b/vendor/github.com/prometheus/procfs/net_ip_socket.go index b70f1fc7a4a..19e3378f72d 100644 --- a/vendor/github.com/prometheus/procfs/net_ip_socket.go +++ b/vendor/github.com/prometheus/procfs/net_ip_socket.go @@ -25,7 +25,7 @@ import ( ) const ( - // readLimit is used by io.LimitReader while reading the content of the + // Maximum size limit used by io.LimitReader while reading the content of the // /proc/net/udp{,6} files. The number of lines inside such a file is dynamic // as each line represents a single used socket. // In theory, the number of available sockets is 65535 (2^16 - 1) per IP. @@ -50,12 +50,12 @@ type ( // UsedSockets shows the total number of parsed lines representing the // number of used sockets. UsedSockets uint64 - // Drops shows the total number of dropped packets of all UPD sockets. + // Drops shows the total number of dropped packets of all UDP sockets. Drops *uint64 } - // netIPSocketLine represents the fields parsed from a single line - // in /proc/net/{t,u}dp{,6}. Fields which are not used by IPSocket are skipped. + // A single line parser for fields from /proc/net/{t,u}dp{,6}. + // Fields which are not used by IPSocket are skipped. // Drops is non-nil for udp{,6}, but nil for tcp{,6}. // For the proc file format details, see https://linux.die.net/man/5/proc. netIPSocketLine struct { diff --git a/vendor/github.com/prometheus/procfs/net_protocols.go b/vendor/github.com/prometheus/procfs/net_protocols.go index b6c77b709fa..8d4b1ac05b0 100644 --- a/vendor/github.com/prometheus/procfs/net_protocols.go +++ b/vendor/github.com/prometheus/procfs/net_protocols.go @@ -115,22 +115,24 @@ func (ps NetProtocolStats) parseLine(rawLine string) (*NetProtocolStatLine, erro if err != nil { return nil, err } - if fields[4] == enabled { + switch fields[4] { + case enabled: line.Pressure = 1 - } else if fields[4] == disabled { + case disabled: line.Pressure = 0 - } else { + default: line.Pressure = -1 } line.MaxHeader, err = strconv.ParseUint(fields[5], 10, 64) if err != nil { return nil, err } - if fields[6] == enabled { + switch fields[6] { + case enabled: line.Slab = true - } else if fields[6] == disabled { + case disabled: line.Slab = false - } else { + default: return nil, fmt.Errorf("%w: capability for protocol: %s", ErrFileParse, line.Name) } line.ModuleName = fields[7] @@ -168,11 +170,12 @@ func (pc *NetProtocolCapabilities) parseCapabilities(capabilities []string) erro } for i := 0; i < len(capabilities); i++ { - if capabilities[i] == "y" { + switch capabilities[i] { + case "y": *capabilityFields[i] = true - } else if capabilities[i] == "n" { + case "n": *capabilityFields[i] = false - } else { + default: return fmt.Errorf("%w: capability block for protocol: position %d", ErrFileParse, i) } } diff --git a/vendor/github.com/prometheus/procfs/net_tcp.go b/vendor/github.com/prometheus/procfs/net_tcp.go index 52776295572..0396d72015c 100644 --- a/vendor/github.com/prometheus/procfs/net_tcp.go +++ b/vendor/github.com/prometheus/procfs/net_tcp.go @@ -25,24 +25,28 @@ type ( // NetTCP returns the IPv4 kernel/networking statistics for TCP datagrams // read from /proc/net/tcp. +// Deprecated: Use github.com/mdlayher/netlink#Conn (with syscall.AF_INET) instead. func (fs FS) NetTCP() (NetTCP, error) { return newNetTCP(fs.proc.Path("net/tcp")) } // NetTCP6 returns the IPv6 kernel/networking statistics for TCP datagrams // read from /proc/net/tcp6. +// Deprecated: Use github.com/mdlayher/netlink#Conn (with syscall.AF_INET6) instead. func (fs FS) NetTCP6() (NetTCP, error) { return newNetTCP(fs.proc.Path("net/tcp6")) } // NetTCPSummary returns already computed statistics like the total queue lengths // for TCP datagrams read from /proc/net/tcp. +// Deprecated: Use github.com/mdlayher/netlink#Conn (with syscall.AF_INET) instead. func (fs FS) NetTCPSummary() (*NetTCPSummary, error) { return newNetTCPSummary(fs.proc.Path("net/tcp")) } // NetTCP6Summary returns already computed statistics like the total queue lengths // for TCP datagrams read from /proc/net/tcp6. +// Deprecated: Use github.com/mdlayher/netlink#Conn (with syscall.AF_INET6) instead. func (fs FS) NetTCP6Summary() (*NetTCPSummary, error) { return newNetTCPSummary(fs.proc.Path("net/tcp6")) } diff --git a/vendor/github.com/prometheus/procfs/net_unix.go b/vendor/github.com/prometheus/procfs/net_unix.go index d868cebdaae..d7e0cacb4c6 100644 --- a/vendor/github.com/prometheus/procfs/net_unix.go +++ b/vendor/github.com/prometheus/procfs/net_unix.go @@ -121,12 +121,12 @@ func parseNetUNIX(r io.Reader) (*NetUNIX, error) { return &nu, nil } -func (u *NetUNIX) parseLine(line string, hasInode bool, min int) (*NetUNIXLine, error) { +func (u *NetUNIX) parseLine(line string, hasInode bool, minFields int) (*NetUNIXLine, error) { fields := strings.Fields(line) l := len(fields) - if l < min { - return nil, fmt.Errorf("%w: expected at least %d fields but got %d", ErrFileParse, min, l) + if l < minFields { + return nil, fmt.Errorf("%w: expected at least %d fields but got %d", ErrFileParse, minFields, l) } // Field offsets are as follows: @@ -172,7 +172,7 @@ func (u *NetUNIX) parseLine(line string, hasInode bool, min int) (*NetUNIXLine, } // Path field is optional. - if l > min { + if l > minFields { // Path occurs at either index 6 or 7 depending on whether inode is // already present. pathIdx := 7 diff --git a/vendor/github.com/prometheus/procfs/proc.go b/vendor/github.com/prometheus/procfs/proc.go index 142796368fe..368187fa884 100644 --- a/vendor/github.com/prometheus/procfs/proc.go +++ b/vendor/github.com/prometheus/procfs/proc.go @@ -37,9 +37,9 @@ type Proc struct { type Procs []Proc var ( - ErrFileParse = errors.New("Error Parsing File") - ErrFileRead = errors.New("Error Reading File") - ErrMountPoint = errors.New("Error Accessing Mount point") + ErrFileParse = errors.New("error parsing file") + ErrFileRead = errors.New("error reading file") + ErrMountPoint = errors.New("error accessing mount point") ) func (p Procs) Len() int { return len(p) } @@ -79,7 +79,7 @@ func (fs FS) Self() (Proc, error) { if err != nil { return Proc{}, err } - pid, err := strconv.Atoi(strings.Replace(p, string(fs.proc), "", -1)) + pid, err := strconv.Atoi(strings.ReplaceAll(p, string(fs.proc), "")) if err != nil { return Proc{}, err } diff --git a/vendor/github.com/prometheus/procfs/proc_cgroup.go b/vendor/github.com/prometheus/procfs/proc_cgroup.go index daeed7f571a..4a64347c03a 100644 --- a/vendor/github.com/prometheus/procfs/proc_cgroup.go +++ b/vendor/github.com/prometheus/procfs/proc_cgroup.go @@ -24,7 +24,7 @@ import ( ) // Cgroup models one line from /proc/[pid]/cgroup. Each Cgroup struct describes the placement of a PID inside a -// specific control hierarchy. The kernel has two cgroup APIs, v1 and v2. v1 has one hierarchy per available resource +// specific control hierarchy. The kernel has two cgroup APIs, v1 and v2. The v1 has one hierarchy per available resource // controller, while v2 has one unified hierarchy shared by all controllers. Regardless of v1 or v2, all hierarchies // contain all running processes, so the question answerable with a Cgroup struct is 'where is this process in // this hierarchy' (where==what path on the specific cgroupfs). By prefixing this path with the mount point of diff --git a/vendor/github.com/prometheus/procfs/proc_io.go b/vendor/github.com/prometheus/procfs/proc_io.go index 776f3497173..d15b66ddb64 100644 --- a/vendor/github.com/prometheus/procfs/proc_io.go +++ b/vendor/github.com/prometheus/procfs/proc_io.go @@ -50,7 +50,7 @@ func (p Proc) IO() (ProcIO, error) { ioFormat := "rchar: %d\nwchar: %d\nsyscr: %d\nsyscw: %d\n" + "read_bytes: %d\nwrite_bytes: %d\n" + - "cancelled_write_bytes: %d\n" + "cancelled_write_bytes: %d\n" //nolint:misspell _, err = fmt.Sscanf(string(data), ioFormat, &pio.RChar, &pio.WChar, &pio.SyscR, &pio.SyscW, &pio.ReadBytes, &pio.WriteBytes, &pio.CancelledWriteBytes) diff --git a/vendor/github.com/prometheus/procfs/proc_netstat.go b/vendor/github.com/prometheus/procfs/proc_netstat.go index 8e3ff4d794b..4248c1716ee 100644 --- a/vendor/github.com/prometheus/procfs/proc_netstat.go +++ b/vendor/github.com/prometheus/procfs/proc_netstat.go @@ -209,232 +209,232 @@ func parseProcNetstat(r io.Reader, fileName string) (ProcNetstat, error) { case "TcpExt": switch key { case "SyncookiesSent": - procNetstat.TcpExt.SyncookiesSent = &value + procNetstat.SyncookiesSent = &value case "SyncookiesRecv": - procNetstat.TcpExt.SyncookiesRecv = &value + procNetstat.SyncookiesRecv = &value case "SyncookiesFailed": - procNetstat.TcpExt.SyncookiesFailed = &value + procNetstat.SyncookiesFailed = &value case "EmbryonicRsts": - procNetstat.TcpExt.EmbryonicRsts = &value + procNetstat.EmbryonicRsts = &value case "PruneCalled": - procNetstat.TcpExt.PruneCalled = &value + procNetstat.PruneCalled = &value case "RcvPruned": - procNetstat.TcpExt.RcvPruned = &value + procNetstat.RcvPruned = &value case "OfoPruned": - procNetstat.TcpExt.OfoPruned = &value + procNetstat.OfoPruned = &value case "OutOfWindowIcmps": - procNetstat.TcpExt.OutOfWindowIcmps = &value + procNetstat.OutOfWindowIcmps = &value case "LockDroppedIcmps": - procNetstat.TcpExt.LockDroppedIcmps = &value + procNetstat.LockDroppedIcmps = &value case "ArpFilter": - procNetstat.TcpExt.ArpFilter = &value + procNetstat.ArpFilter = &value case "TW": - procNetstat.TcpExt.TW = &value + procNetstat.TW = &value case "TWRecycled": - procNetstat.TcpExt.TWRecycled = &value + procNetstat.TWRecycled = &value case "TWKilled": - procNetstat.TcpExt.TWKilled = &value + procNetstat.TWKilled = &value case "PAWSActive": - procNetstat.TcpExt.PAWSActive = &value + procNetstat.PAWSActive = &value case "PAWSEstab": - procNetstat.TcpExt.PAWSEstab = &value + procNetstat.PAWSEstab = &value case "DelayedACKs": - procNetstat.TcpExt.DelayedACKs = &value + procNetstat.DelayedACKs = &value case "DelayedACKLocked": - procNetstat.TcpExt.DelayedACKLocked = &value + procNetstat.DelayedACKLocked = &value case "DelayedACKLost": - procNetstat.TcpExt.DelayedACKLost = &value + procNetstat.DelayedACKLost = &value case "ListenOverflows": - procNetstat.TcpExt.ListenOverflows = &value + procNetstat.ListenOverflows = &value case "ListenDrops": - procNetstat.TcpExt.ListenDrops = &value + procNetstat.ListenDrops = &value case "TCPHPHits": - procNetstat.TcpExt.TCPHPHits = &value + procNetstat.TCPHPHits = &value case "TCPPureAcks": - procNetstat.TcpExt.TCPPureAcks = &value + procNetstat.TCPPureAcks = &value case "TCPHPAcks": - procNetstat.TcpExt.TCPHPAcks = &value + procNetstat.TCPHPAcks = &value case "TCPRenoRecovery": - procNetstat.TcpExt.TCPRenoRecovery = &value + procNetstat.TCPRenoRecovery = &value case "TCPSackRecovery": - procNetstat.TcpExt.TCPSackRecovery = &value + procNetstat.TCPSackRecovery = &value case "TCPSACKReneging": - procNetstat.TcpExt.TCPSACKReneging = &value + procNetstat.TCPSACKReneging = &value case "TCPSACKReorder": - procNetstat.TcpExt.TCPSACKReorder = &value + procNetstat.TCPSACKReorder = &value case "TCPRenoReorder": - procNetstat.TcpExt.TCPRenoReorder = &value + procNetstat.TCPRenoReorder = &value case "TCPTSReorder": - procNetstat.TcpExt.TCPTSReorder = &value + procNetstat.TCPTSReorder = &value case "TCPFullUndo": - procNetstat.TcpExt.TCPFullUndo = &value + procNetstat.TCPFullUndo = &value case "TCPPartialUndo": - procNetstat.TcpExt.TCPPartialUndo = &value + procNetstat.TCPPartialUndo = &value case "TCPDSACKUndo": - procNetstat.TcpExt.TCPDSACKUndo = &value + procNetstat.TCPDSACKUndo = &value case "TCPLossUndo": - procNetstat.TcpExt.TCPLossUndo = &value + procNetstat.TCPLossUndo = &value case "TCPLostRetransmit": - procNetstat.TcpExt.TCPLostRetransmit = &value + procNetstat.TCPLostRetransmit = &value case "TCPRenoFailures": - procNetstat.TcpExt.TCPRenoFailures = &value + procNetstat.TCPRenoFailures = &value case "TCPSackFailures": - procNetstat.TcpExt.TCPSackFailures = &value + procNetstat.TCPSackFailures = &value case "TCPLossFailures": - procNetstat.TcpExt.TCPLossFailures = &value + procNetstat.TCPLossFailures = &value case "TCPFastRetrans": - procNetstat.TcpExt.TCPFastRetrans = &value + procNetstat.TCPFastRetrans = &value case "TCPSlowStartRetrans": - procNetstat.TcpExt.TCPSlowStartRetrans = &value + procNetstat.TCPSlowStartRetrans = &value case "TCPTimeouts": - procNetstat.TcpExt.TCPTimeouts = &value + procNetstat.TCPTimeouts = &value case "TCPLossProbes": - procNetstat.TcpExt.TCPLossProbes = &value + procNetstat.TCPLossProbes = &value case "TCPLossProbeRecovery": - procNetstat.TcpExt.TCPLossProbeRecovery = &value + procNetstat.TCPLossProbeRecovery = &value case "TCPRenoRecoveryFail": - procNetstat.TcpExt.TCPRenoRecoveryFail = &value + procNetstat.TCPRenoRecoveryFail = &value case "TCPSackRecoveryFail": - procNetstat.TcpExt.TCPSackRecoveryFail = &value + procNetstat.TCPSackRecoveryFail = &value case "TCPRcvCollapsed": - procNetstat.TcpExt.TCPRcvCollapsed = &value + procNetstat.TCPRcvCollapsed = &value case "TCPDSACKOldSent": - procNetstat.TcpExt.TCPDSACKOldSent = &value + procNetstat.TCPDSACKOldSent = &value case "TCPDSACKOfoSent": - procNetstat.TcpExt.TCPDSACKOfoSent = &value + procNetstat.TCPDSACKOfoSent = &value case "TCPDSACKRecv": - procNetstat.TcpExt.TCPDSACKRecv = &value + procNetstat.TCPDSACKRecv = &value case "TCPDSACKOfoRecv": - procNetstat.TcpExt.TCPDSACKOfoRecv = &value + procNetstat.TCPDSACKOfoRecv = &value case "TCPAbortOnData": - procNetstat.TcpExt.TCPAbortOnData = &value + procNetstat.TCPAbortOnData = &value case "TCPAbortOnClose": - procNetstat.TcpExt.TCPAbortOnClose = &value + procNetstat.TCPAbortOnClose = &value case "TCPDeferAcceptDrop": - procNetstat.TcpExt.TCPDeferAcceptDrop = &value + procNetstat.TCPDeferAcceptDrop = &value case "IPReversePathFilter": - procNetstat.TcpExt.IPReversePathFilter = &value + procNetstat.IPReversePathFilter = &value case "TCPTimeWaitOverflow": - procNetstat.TcpExt.TCPTimeWaitOverflow = &value + procNetstat.TCPTimeWaitOverflow = &value case "TCPReqQFullDoCookies": - procNetstat.TcpExt.TCPReqQFullDoCookies = &value + procNetstat.TCPReqQFullDoCookies = &value case "TCPReqQFullDrop": - procNetstat.TcpExt.TCPReqQFullDrop = &value + procNetstat.TCPReqQFullDrop = &value case "TCPRetransFail": - procNetstat.TcpExt.TCPRetransFail = &value + procNetstat.TCPRetransFail = &value case "TCPRcvCoalesce": - procNetstat.TcpExt.TCPRcvCoalesce = &value + procNetstat.TCPRcvCoalesce = &value case "TCPRcvQDrop": - procNetstat.TcpExt.TCPRcvQDrop = &value + procNetstat.TCPRcvQDrop = &value case "TCPOFOQueue": - procNetstat.TcpExt.TCPOFOQueue = &value + procNetstat.TCPOFOQueue = &value case "TCPOFODrop": - procNetstat.TcpExt.TCPOFODrop = &value + procNetstat.TCPOFODrop = &value case "TCPOFOMerge": - procNetstat.TcpExt.TCPOFOMerge = &value + procNetstat.TCPOFOMerge = &value case "TCPChallengeACK": - procNetstat.TcpExt.TCPChallengeACK = &value + procNetstat.TCPChallengeACK = &value case "TCPSYNChallenge": - procNetstat.TcpExt.TCPSYNChallenge = &value + procNetstat.TCPSYNChallenge = &value case "TCPFastOpenActive": - procNetstat.TcpExt.TCPFastOpenActive = &value + procNetstat.TCPFastOpenActive = &value case "TCPFastOpenActiveFail": - procNetstat.TcpExt.TCPFastOpenActiveFail = &value + procNetstat.TCPFastOpenActiveFail = &value case "TCPFastOpenPassive": - procNetstat.TcpExt.TCPFastOpenPassive = &value + procNetstat.TCPFastOpenPassive = &value case "TCPFastOpenPassiveFail": - procNetstat.TcpExt.TCPFastOpenPassiveFail = &value + procNetstat.TCPFastOpenPassiveFail = &value case "TCPFastOpenListenOverflow": - procNetstat.TcpExt.TCPFastOpenListenOverflow = &value + procNetstat.TCPFastOpenListenOverflow = &value case "TCPFastOpenCookieReqd": - procNetstat.TcpExt.TCPFastOpenCookieReqd = &value + procNetstat.TCPFastOpenCookieReqd = &value case "TCPFastOpenBlackhole": - procNetstat.TcpExt.TCPFastOpenBlackhole = &value + procNetstat.TCPFastOpenBlackhole = &value case "TCPSpuriousRtxHostQueues": - procNetstat.TcpExt.TCPSpuriousRtxHostQueues = &value + procNetstat.TCPSpuriousRtxHostQueues = &value case "BusyPollRxPackets": - procNetstat.TcpExt.BusyPollRxPackets = &value + procNetstat.BusyPollRxPackets = &value case "TCPAutoCorking": - procNetstat.TcpExt.TCPAutoCorking = &value + procNetstat.TCPAutoCorking = &value case "TCPFromZeroWindowAdv": - procNetstat.TcpExt.TCPFromZeroWindowAdv = &value + procNetstat.TCPFromZeroWindowAdv = &value case "TCPToZeroWindowAdv": - procNetstat.TcpExt.TCPToZeroWindowAdv = &value + procNetstat.TCPToZeroWindowAdv = &value case "TCPWantZeroWindowAdv": - procNetstat.TcpExt.TCPWantZeroWindowAdv = &value + procNetstat.TCPWantZeroWindowAdv = &value case "TCPSynRetrans": - procNetstat.TcpExt.TCPSynRetrans = &value + procNetstat.TCPSynRetrans = &value case "TCPOrigDataSent": - procNetstat.TcpExt.TCPOrigDataSent = &value + procNetstat.TCPOrigDataSent = &value case "TCPHystartTrainDetect": - procNetstat.TcpExt.TCPHystartTrainDetect = &value + procNetstat.TCPHystartTrainDetect = &value case "TCPHystartTrainCwnd": - procNetstat.TcpExt.TCPHystartTrainCwnd = &value + procNetstat.TCPHystartTrainCwnd = &value case "TCPHystartDelayDetect": - procNetstat.TcpExt.TCPHystartDelayDetect = &value + procNetstat.TCPHystartDelayDetect = &value case "TCPHystartDelayCwnd": - procNetstat.TcpExt.TCPHystartDelayCwnd = &value + procNetstat.TCPHystartDelayCwnd = &value case "TCPACKSkippedSynRecv": - procNetstat.TcpExt.TCPACKSkippedSynRecv = &value + procNetstat.TCPACKSkippedSynRecv = &value case "TCPACKSkippedPAWS": - procNetstat.TcpExt.TCPACKSkippedPAWS = &value + procNetstat.TCPACKSkippedPAWS = &value case "TCPACKSkippedSeq": - procNetstat.TcpExt.TCPACKSkippedSeq = &value + procNetstat.TCPACKSkippedSeq = &value case "TCPACKSkippedFinWait2": - procNetstat.TcpExt.TCPACKSkippedFinWait2 = &value + procNetstat.TCPACKSkippedFinWait2 = &value case "TCPACKSkippedTimeWait": - procNetstat.TcpExt.TCPACKSkippedTimeWait = &value + procNetstat.TCPACKSkippedTimeWait = &value case "TCPACKSkippedChallenge": - procNetstat.TcpExt.TCPACKSkippedChallenge = &value + procNetstat.TCPACKSkippedChallenge = &value case "TCPWinProbe": - procNetstat.TcpExt.TCPWinProbe = &value + procNetstat.TCPWinProbe = &value case "TCPKeepAlive": - procNetstat.TcpExt.TCPKeepAlive = &value + procNetstat.TCPKeepAlive = &value case "TCPMTUPFail": - procNetstat.TcpExt.TCPMTUPFail = &value + procNetstat.TCPMTUPFail = &value case "TCPMTUPSuccess": - procNetstat.TcpExt.TCPMTUPSuccess = &value + procNetstat.TCPMTUPSuccess = &value case "TCPWqueueTooBig": - procNetstat.TcpExt.TCPWqueueTooBig = &value + procNetstat.TCPWqueueTooBig = &value } case "IpExt": switch key { case "InNoRoutes": - procNetstat.IpExt.InNoRoutes = &value + procNetstat.InNoRoutes = &value case "InTruncatedPkts": - procNetstat.IpExt.InTruncatedPkts = &value + procNetstat.InTruncatedPkts = &value case "InMcastPkts": - procNetstat.IpExt.InMcastPkts = &value + procNetstat.InMcastPkts = &value case "OutMcastPkts": - procNetstat.IpExt.OutMcastPkts = &value + procNetstat.OutMcastPkts = &value case "InBcastPkts": - procNetstat.IpExt.InBcastPkts = &value + procNetstat.InBcastPkts = &value case "OutBcastPkts": - procNetstat.IpExt.OutBcastPkts = &value + procNetstat.OutBcastPkts = &value case "InOctets": - procNetstat.IpExt.InOctets = &value + procNetstat.InOctets = &value case "OutOctets": - procNetstat.IpExt.OutOctets = &value + procNetstat.OutOctets = &value case "InMcastOctets": - procNetstat.IpExt.InMcastOctets = &value + procNetstat.InMcastOctets = &value case "OutMcastOctets": - procNetstat.IpExt.OutMcastOctets = &value + procNetstat.OutMcastOctets = &value case "InBcastOctets": - procNetstat.IpExt.InBcastOctets = &value + procNetstat.InBcastOctets = &value case "OutBcastOctets": - procNetstat.IpExt.OutBcastOctets = &value + procNetstat.OutBcastOctets = &value case "InCsumErrors": - procNetstat.IpExt.InCsumErrors = &value + procNetstat.InCsumErrors = &value case "InNoECTPkts": - procNetstat.IpExt.InNoECTPkts = &value + procNetstat.InNoECTPkts = &value case "InECT1Pkts": - procNetstat.IpExt.InECT1Pkts = &value + procNetstat.InECT1Pkts = &value case "InECT0Pkts": - procNetstat.IpExt.InECT0Pkts = &value + procNetstat.InECT0Pkts = &value case "InCEPkts": - procNetstat.IpExt.InCEPkts = &value + procNetstat.InCEPkts = &value case "ReasmOverlaps": - procNetstat.IpExt.ReasmOverlaps = &value + procNetstat.ReasmOverlaps = &value } } } diff --git a/vendor/github.com/prometheus/procfs/proc_smaps.go b/vendor/github.com/prometheus/procfs/proc_smaps.go index 09060e82080..9a297afcf89 100644 --- a/vendor/github.com/prometheus/procfs/proc_smaps.go +++ b/vendor/github.com/prometheus/procfs/proc_smaps.go @@ -19,7 +19,6 @@ package procfs import ( "bufio" "errors" - "fmt" "os" "regexp" "strconv" @@ -29,7 +28,7 @@ import ( ) var ( - // match the header line before each mapped zone in `/proc/pid/smaps`. + // Match the header line before each mapped zone in `/proc/pid/smaps`. procSMapsHeaderLine = regexp.MustCompile(`^[a-f0-9].*$`) ) @@ -117,7 +116,6 @@ func (p Proc) procSMapsRollupManual() (ProcSMapsRollup, error) { func (s *ProcSMapsRollup) parseLine(line string) error { kv := strings.SplitN(line, ":", 2) if len(kv) != 2 { - fmt.Println(line) return errors.New("invalid net/dev line, missing colon") } diff --git a/vendor/github.com/prometheus/procfs/proc_snmp.go b/vendor/github.com/prometheus/procfs/proc_snmp.go index b9d2cf642a7..4bdc90b07ea 100644 --- a/vendor/github.com/prometheus/procfs/proc_snmp.go +++ b/vendor/github.com/prometheus/procfs/proc_snmp.go @@ -173,138 +173,138 @@ func parseSnmp(r io.Reader, fileName string) (ProcSnmp, error) { case "Ip": switch key { case "Forwarding": - procSnmp.Ip.Forwarding = &value + procSnmp.Forwarding = &value case "DefaultTTL": - procSnmp.Ip.DefaultTTL = &value + procSnmp.DefaultTTL = &value case "InReceives": - procSnmp.Ip.InReceives = &value + procSnmp.InReceives = &value case "InHdrErrors": - procSnmp.Ip.InHdrErrors = &value + procSnmp.InHdrErrors = &value case "InAddrErrors": - procSnmp.Ip.InAddrErrors = &value + procSnmp.InAddrErrors = &value case "ForwDatagrams": - procSnmp.Ip.ForwDatagrams = &value + procSnmp.ForwDatagrams = &value case "InUnknownProtos": - procSnmp.Ip.InUnknownProtos = &value + procSnmp.InUnknownProtos = &value case "InDiscards": - procSnmp.Ip.InDiscards = &value + procSnmp.InDiscards = &value case "InDelivers": - procSnmp.Ip.InDelivers = &value + procSnmp.InDelivers = &value case "OutRequests": - procSnmp.Ip.OutRequests = &value + procSnmp.OutRequests = &value case "OutDiscards": - procSnmp.Ip.OutDiscards = &value + procSnmp.OutDiscards = &value case "OutNoRoutes": - procSnmp.Ip.OutNoRoutes = &value + procSnmp.OutNoRoutes = &value case "ReasmTimeout": - procSnmp.Ip.ReasmTimeout = &value + procSnmp.ReasmTimeout = &value case "ReasmReqds": - procSnmp.Ip.ReasmReqds = &value + procSnmp.ReasmReqds = &value case "ReasmOKs": - procSnmp.Ip.ReasmOKs = &value + procSnmp.ReasmOKs = &value case "ReasmFails": - procSnmp.Ip.ReasmFails = &value + procSnmp.ReasmFails = &value case "FragOKs": - procSnmp.Ip.FragOKs = &value + procSnmp.FragOKs = &value case "FragFails": - procSnmp.Ip.FragFails = &value + procSnmp.FragFails = &value case "FragCreates": - procSnmp.Ip.FragCreates = &value + procSnmp.FragCreates = &value } case "Icmp": switch key { case "InMsgs": - procSnmp.Icmp.InMsgs = &value + procSnmp.InMsgs = &value case "InErrors": procSnmp.Icmp.InErrors = &value case "InCsumErrors": procSnmp.Icmp.InCsumErrors = &value case "InDestUnreachs": - procSnmp.Icmp.InDestUnreachs = &value + procSnmp.InDestUnreachs = &value case "InTimeExcds": - procSnmp.Icmp.InTimeExcds = &value + procSnmp.InTimeExcds = &value case "InParmProbs": - procSnmp.Icmp.InParmProbs = &value + procSnmp.InParmProbs = &value case "InSrcQuenchs": - procSnmp.Icmp.InSrcQuenchs = &value + procSnmp.InSrcQuenchs = &value case "InRedirects": - procSnmp.Icmp.InRedirects = &value + procSnmp.InRedirects = &value case "InEchos": - procSnmp.Icmp.InEchos = &value + procSnmp.InEchos = &value case "InEchoReps": - procSnmp.Icmp.InEchoReps = &value + procSnmp.InEchoReps = &value case "InTimestamps": - procSnmp.Icmp.InTimestamps = &value + procSnmp.InTimestamps = &value case "InTimestampReps": - procSnmp.Icmp.InTimestampReps = &value + procSnmp.InTimestampReps = &value case "InAddrMasks": - procSnmp.Icmp.InAddrMasks = &value + procSnmp.InAddrMasks = &value case "InAddrMaskReps": - procSnmp.Icmp.InAddrMaskReps = &value + procSnmp.InAddrMaskReps = &value case "OutMsgs": - procSnmp.Icmp.OutMsgs = &value + procSnmp.OutMsgs = &value case "OutErrors": - procSnmp.Icmp.OutErrors = &value + procSnmp.OutErrors = &value case "OutDestUnreachs": - procSnmp.Icmp.OutDestUnreachs = &value + procSnmp.OutDestUnreachs = &value case "OutTimeExcds": - procSnmp.Icmp.OutTimeExcds = &value + procSnmp.OutTimeExcds = &value case "OutParmProbs": - procSnmp.Icmp.OutParmProbs = &value + procSnmp.OutParmProbs = &value case "OutSrcQuenchs": - procSnmp.Icmp.OutSrcQuenchs = &value + procSnmp.OutSrcQuenchs = &value case "OutRedirects": - procSnmp.Icmp.OutRedirects = &value + procSnmp.OutRedirects = &value case "OutEchos": - procSnmp.Icmp.OutEchos = &value + procSnmp.OutEchos = &value case "OutEchoReps": - procSnmp.Icmp.OutEchoReps = &value + procSnmp.OutEchoReps = &value case "OutTimestamps": - procSnmp.Icmp.OutTimestamps = &value + procSnmp.OutTimestamps = &value case "OutTimestampReps": - procSnmp.Icmp.OutTimestampReps = &value + procSnmp.OutTimestampReps = &value case "OutAddrMasks": - procSnmp.Icmp.OutAddrMasks = &value + procSnmp.OutAddrMasks = &value case "OutAddrMaskReps": - procSnmp.Icmp.OutAddrMaskReps = &value + procSnmp.OutAddrMaskReps = &value } case "IcmpMsg": switch key { case "InType3": - procSnmp.IcmpMsg.InType3 = &value + procSnmp.InType3 = &value case "OutType3": - procSnmp.IcmpMsg.OutType3 = &value + procSnmp.OutType3 = &value } case "Tcp": switch key { case "RtoAlgorithm": - procSnmp.Tcp.RtoAlgorithm = &value + procSnmp.RtoAlgorithm = &value case "RtoMin": - procSnmp.Tcp.RtoMin = &value + procSnmp.RtoMin = &value case "RtoMax": - procSnmp.Tcp.RtoMax = &value + procSnmp.RtoMax = &value case "MaxConn": - procSnmp.Tcp.MaxConn = &value + procSnmp.MaxConn = &value case "ActiveOpens": - procSnmp.Tcp.ActiveOpens = &value + procSnmp.ActiveOpens = &value case "PassiveOpens": - procSnmp.Tcp.PassiveOpens = &value + procSnmp.PassiveOpens = &value case "AttemptFails": - procSnmp.Tcp.AttemptFails = &value + procSnmp.AttemptFails = &value case "EstabResets": - procSnmp.Tcp.EstabResets = &value + procSnmp.EstabResets = &value case "CurrEstab": - procSnmp.Tcp.CurrEstab = &value + procSnmp.CurrEstab = &value case "InSegs": - procSnmp.Tcp.InSegs = &value + procSnmp.InSegs = &value case "OutSegs": - procSnmp.Tcp.OutSegs = &value + procSnmp.OutSegs = &value case "RetransSegs": - procSnmp.Tcp.RetransSegs = &value + procSnmp.RetransSegs = &value case "InErrs": - procSnmp.Tcp.InErrs = &value + procSnmp.InErrs = &value case "OutRsts": - procSnmp.Tcp.OutRsts = &value + procSnmp.OutRsts = &value case "InCsumErrors": procSnmp.Tcp.InCsumErrors = &value } diff --git a/vendor/github.com/prometheus/procfs/proc_snmp6.go b/vendor/github.com/prometheus/procfs/proc_snmp6.go index 3059cc6a136..fb7fd3995be 100644 --- a/vendor/github.com/prometheus/procfs/proc_snmp6.go +++ b/vendor/github.com/prometheus/procfs/proc_snmp6.go @@ -182,161 +182,161 @@ func parseSNMP6Stats(r io.Reader) (ProcSnmp6, error) { case "Ip6": switch key { case "InReceives": - procSnmp6.Ip6.InReceives = &value + procSnmp6.InReceives = &value case "InHdrErrors": - procSnmp6.Ip6.InHdrErrors = &value + procSnmp6.InHdrErrors = &value case "InTooBigErrors": - procSnmp6.Ip6.InTooBigErrors = &value + procSnmp6.InTooBigErrors = &value case "InNoRoutes": - procSnmp6.Ip6.InNoRoutes = &value + procSnmp6.InNoRoutes = &value case "InAddrErrors": - procSnmp6.Ip6.InAddrErrors = &value + procSnmp6.InAddrErrors = &value case "InUnknownProtos": - procSnmp6.Ip6.InUnknownProtos = &value + procSnmp6.InUnknownProtos = &value case "InTruncatedPkts": - procSnmp6.Ip6.InTruncatedPkts = &value + procSnmp6.InTruncatedPkts = &value case "InDiscards": - procSnmp6.Ip6.InDiscards = &value + procSnmp6.InDiscards = &value case "InDelivers": - procSnmp6.Ip6.InDelivers = &value + procSnmp6.InDelivers = &value case "OutForwDatagrams": - procSnmp6.Ip6.OutForwDatagrams = &value + procSnmp6.OutForwDatagrams = &value case "OutRequests": - procSnmp6.Ip6.OutRequests = &value + procSnmp6.OutRequests = &value case "OutDiscards": - procSnmp6.Ip6.OutDiscards = &value + procSnmp6.OutDiscards = &value case "OutNoRoutes": - procSnmp6.Ip6.OutNoRoutes = &value + procSnmp6.OutNoRoutes = &value case "ReasmTimeout": - procSnmp6.Ip6.ReasmTimeout = &value + procSnmp6.ReasmTimeout = &value case "ReasmReqds": - procSnmp6.Ip6.ReasmReqds = &value + procSnmp6.ReasmReqds = &value case "ReasmOKs": - procSnmp6.Ip6.ReasmOKs = &value + procSnmp6.ReasmOKs = &value case "ReasmFails": - procSnmp6.Ip6.ReasmFails = &value + procSnmp6.ReasmFails = &value case "FragOKs": - procSnmp6.Ip6.FragOKs = &value + procSnmp6.FragOKs = &value case "FragFails": - procSnmp6.Ip6.FragFails = &value + procSnmp6.FragFails = &value case "FragCreates": - procSnmp6.Ip6.FragCreates = &value + procSnmp6.FragCreates = &value case "InMcastPkts": - procSnmp6.Ip6.InMcastPkts = &value + procSnmp6.InMcastPkts = &value case "OutMcastPkts": - procSnmp6.Ip6.OutMcastPkts = &value + procSnmp6.OutMcastPkts = &value case "InOctets": - procSnmp6.Ip6.InOctets = &value + procSnmp6.InOctets = &value case "OutOctets": - procSnmp6.Ip6.OutOctets = &value + procSnmp6.OutOctets = &value case "InMcastOctets": - procSnmp6.Ip6.InMcastOctets = &value + procSnmp6.InMcastOctets = &value case "OutMcastOctets": - procSnmp6.Ip6.OutMcastOctets = &value + procSnmp6.OutMcastOctets = &value case "InBcastOctets": - procSnmp6.Ip6.InBcastOctets = &value + procSnmp6.InBcastOctets = &value case "OutBcastOctets": - procSnmp6.Ip6.OutBcastOctets = &value + procSnmp6.OutBcastOctets = &value case "InNoECTPkts": - procSnmp6.Ip6.InNoECTPkts = &value + procSnmp6.InNoECTPkts = &value case "InECT1Pkts": - procSnmp6.Ip6.InECT1Pkts = &value + procSnmp6.InECT1Pkts = &value case "InECT0Pkts": - procSnmp6.Ip6.InECT0Pkts = &value + procSnmp6.InECT0Pkts = &value case "InCEPkts": - procSnmp6.Ip6.InCEPkts = &value + procSnmp6.InCEPkts = &value } case "Icmp6": switch key { case "InMsgs": - procSnmp6.Icmp6.InMsgs = &value + procSnmp6.InMsgs = &value case "InErrors": procSnmp6.Icmp6.InErrors = &value case "OutMsgs": - procSnmp6.Icmp6.OutMsgs = &value + procSnmp6.OutMsgs = &value case "OutErrors": - procSnmp6.Icmp6.OutErrors = &value + procSnmp6.OutErrors = &value case "InCsumErrors": procSnmp6.Icmp6.InCsumErrors = &value case "InDestUnreachs": - procSnmp6.Icmp6.InDestUnreachs = &value + procSnmp6.InDestUnreachs = &value case "InPktTooBigs": - procSnmp6.Icmp6.InPktTooBigs = &value + procSnmp6.InPktTooBigs = &value case "InTimeExcds": - procSnmp6.Icmp6.InTimeExcds = &value + procSnmp6.InTimeExcds = &value case "InParmProblems": - procSnmp6.Icmp6.InParmProblems = &value + procSnmp6.InParmProblems = &value case "InEchos": - procSnmp6.Icmp6.InEchos = &value + procSnmp6.InEchos = &value case "InEchoReplies": - procSnmp6.Icmp6.InEchoReplies = &value + procSnmp6.InEchoReplies = &value case "InGroupMembQueries": - procSnmp6.Icmp6.InGroupMembQueries = &value + procSnmp6.InGroupMembQueries = &value case "InGroupMembResponses": - procSnmp6.Icmp6.InGroupMembResponses = &value + procSnmp6.InGroupMembResponses = &value case "InGroupMembReductions": - procSnmp6.Icmp6.InGroupMembReductions = &value + procSnmp6.InGroupMembReductions = &value case "InRouterSolicits": - procSnmp6.Icmp6.InRouterSolicits = &value + procSnmp6.InRouterSolicits = &value case "InRouterAdvertisements": - procSnmp6.Icmp6.InRouterAdvertisements = &value + procSnmp6.InRouterAdvertisements = &value case "InNeighborSolicits": - procSnmp6.Icmp6.InNeighborSolicits = &value + procSnmp6.InNeighborSolicits = &value case "InNeighborAdvertisements": - procSnmp6.Icmp6.InNeighborAdvertisements = &value + procSnmp6.InNeighborAdvertisements = &value case "InRedirects": - procSnmp6.Icmp6.InRedirects = &value + procSnmp6.InRedirects = &value case "InMLDv2Reports": - procSnmp6.Icmp6.InMLDv2Reports = &value + procSnmp6.InMLDv2Reports = &value case "OutDestUnreachs": - procSnmp6.Icmp6.OutDestUnreachs = &value + procSnmp6.OutDestUnreachs = &value case "OutPktTooBigs": - procSnmp6.Icmp6.OutPktTooBigs = &value + procSnmp6.OutPktTooBigs = &value case "OutTimeExcds": - procSnmp6.Icmp6.OutTimeExcds = &value + procSnmp6.OutTimeExcds = &value case "OutParmProblems": - procSnmp6.Icmp6.OutParmProblems = &value + procSnmp6.OutParmProblems = &value case "OutEchos": - procSnmp6.Icmp6.OutEchos = &value + procSnmp6.OutEchos = &value case "OutEchoReplies": - procSnmp6.Icmp6.OutEchoReplies = &value + procSnmp6.OutEchoReplies = &value case "OutGroupMembQueries": - procSnmp6.Icmp6.OutGroupMembQueries = &value + procSnmp6.OutGroupMembQueries = &value case "OutGroupMembResponses": - procSnmp6.Icmp6.OutGroupMembResponses = &value + procSnmp6.OutGroupMembResponses = &value case "OutGroupMembReductions": - procSnmp6.Icmp6.OutGroupMembReductions = &value + procSnmp6.OutGroupMembReductions = &value case "OutRouterSolicits": - procSnmp6.Icmp6.OutRouterSolicits = &value + procSnmp6.OutRouterSolicits = &value case "OutRouterAdvertisements": - procSnmp6.Icmp6.OutRouterAdvertisements = &value + procSnmp6.OutRouterAdvertisements = &value case "OutNeighborSolicits": - procSnmp6.Icmp6.OutNeighborSolicits = &value + procSnmp6.OutNeighborSolicits = &value case "OutNeighborAdvertisements": - procSnmp6.Icmp6.OutNeighborAdvertisements = &value + procSnmp6.OutNeighborAdvertisements = &value case "OutRedirects": - procSnmp6.Icmp6.OutRedirects = &value + procSnmp6.OutRedirects = &value case "OutMLDv2Reports": - procSnmp6.Icmp6.OutMLDv2Reports = &value + procSnmp6.OutMLDv2Reports = &value case "InType1": - procSnmp6.Icmp6.InType1 = &value + procSnmp6.InType1 = &value case "InType134": - procSnmp6.Icmp6.InType134 = &value + procSnmp6.InType134 = &value case "InType135": - procSnmp6.Icmp6.InType135 = &value + procSnmp6.InType135 = &value case "InType136": - procSnmp6.Icmp6.InType136 = &value + procSnmp6.InType136 = &value case "InType143": - procSnmp6.Icmp6.InType143 = &value + procSnmp6.InType143 = &value case "OutType133": - procSnmp6.Icmp6.OutType133 = &value + procSnmp6.OutType133 = &value case "OutType135": - procSnmp6.Icmp6.OutType135 = &value + procSnmp6.OutType135 = &value case "OutType136": - procSnmp6.Icmp6.OutType136 = &value + procSnmp6.OutType136 = &value case "OutType143": - procSnmp6.Icmp6.OutType143 = &value + procSnmp6.OutType143 = &value } case "Udp6": switch key { @@ -355,7 +355,7 @@ func parseSNMP6Stats(r io.Reader) (ProcSnmp6, error) { case "InCsumErrors": procSnmp6.Udp6.InCsumErrors = &value case "IgnoredMulti": - procSnmp6.Udp6.IgnoredMulti = &value + procSnmp6.IgnoredMulti = &value } case "UdpLite6": switch key { diff --git a/vendor/github.com/prometheus/procfs/proc_status.go b/vendor/github.com/prometheus/procfs/proc_status.go index a055197c63e..dd8aa56885e 100644 --- a/vendor/github.com/prometheus/procfs/proc_status.go +++ b/vendor/github.com/prometheus/procfs/proc_status.go @@ -146,7 +146,11 @@ func (s *ProcStatus) fillStatus(k string, vString string, vUint uint64, vUintByt } } case "NSpid": - s.NSpids = calcNSPidsList(vString) + nspids, err := calcNSPidsList(vString) + if err != nil { + return err + } + s.NSpids = nspids case "VmPeak": s.VmPeak = vUintBytes case "VmSize": @@ -222,17 +226,17 @@ func calcCpusAllowedList(cpuString string) []uint64 { return g } -func calcNSPidsList(nspidsString string) []uint64 { - s := strings.Split(nspidsString, " ") +func calcNSPidsList(nspidsString string) ([]uint64, error) { + s := strings.Split(nspidsString, "\t") var nspids []uint64 for _, nspid := range s { - nspid, _ := strconv.ParseUint(nspid, 10, 64) - if nspid == 0 { - continue + nspid, err := strconv.ParseUint(nspid, 10, 64) + if err != nil { + return nil, err } nspids = append(nspids, nspid) } - return nspids + return nspids, nil } diff --git a/vendor/github.com/prometheus/procfs/proc_sys.go b/vendor/github.com/prometheus/procfs/proc_sys.go index 5eefbe2ef8b..3810d1ac999 100644 --- a/vendor/github.com/prometheus/procfs/proc_sys.go +++ b/vendor/github.com/prometheus/procfs/proc_sys.go @@ -21,7 +21,7 @@ import ( ) func sysctlToPath(sysctl string) string { - return strings.Replace(sysctl, ".", "/", -1) + return strings.ReplaceAll(sysctl, ".", "/") } func (fs FS) SysctlStrings(sysctl string) ([]string, error) { diff --git a/vendor/github.com/prometheus/procfs/softirqs.go b/vendor/github.com/prometheus/procfs/softirqs.go index 28708e07459..403e6ae7086 100644 --- a/vendor/github.com/prometheus/procfs/softirqs.go +++ b/vendor/github.com/prometheus/procfs/softirqs.go @@ -68,8 +68,8 @@ func parseSoftirqs(r io.Reader) (Softirqs, error) { if len(parts) < 2 { continue } - switch { - case parts[0] == "HI:": + switch parts[0] { + case "HI:": perCPU := parts[1:] softirqs.Hi = make([]uint64, len(perCPU)) for i, count := range perCPU { @@ -77,7 +77,7 @@ func parseSoftirqs(r io.Reader) (Softirqs, error) { return Softirqs{}, fmt.Errorf("%w: couldn't parse %q (HI%d): %w", ErrFileParse, count, i, err) } } - case parts[0] == "TIMER:": + case "TIMER:": perCPU := parts[1:] softirqs.Timer = make([]uint64, len(perCPU)) for i, count := range perCPU { @@ -85,7 +85,7 @@ func parseSoftirqs(r io.Reader) (Softirqs, error) { return Softirqs{}, fmt.Errorf("%w: couldn't parse %q (TIMER%d): %w", ErrFileParse, count, i, err) } } - case parts[0] == "NET_TX:": + case "NET_TX:": perCPU := parts[1:] softirqs.NetTx = make([]uint64, len(perCPU)) for i, count := range perCPU { @@ -93,7 +93,7 @@ func parseSoftirqs(r io.Reader) (Softirqs, error) { return Softirqs{}, fmt.Errorf("%w: couldn't parse %q (NET_TX%d): %w", ErrFileParse, count, i, err) } } - case parts[0] == "NET_RX:": + case "NET_RX:": perCPU := parts[1:] softirqs.NetRx = make([]uint64, len(perCPU)) for i, count := range perCPU { @@ -101,7 +101,7 @@ func parseSoftirqs(r io.Reader) (Softirqs, error) { return Softirqs{}, fmt.Errorf("%w: couldn't parse %q (NET_RX%d): %w", ErrFileParse, count, i, err) } } - case parts[0] == "BLOCK:": + case "BLOCK:": perCPU := parts[1:] softirqs.Block = make([]uint64, len(perCPU)) for i, count := range perCPU { @@ -109,7 +109,7 @@ func parseSoftirqs(r io.Reader) (Softirqs, error) { return Softirqs{}, fmt.Errorf("%w: couldn't parse %q (BLOCK%d): %w", ErrFileParse, count, i, err) } } - case parts[0] == "IRQ_POLL:": + case "IRQ_POLL:": perCPU := parts[1:] softirqs.IRQPoll = make([]uint64, len(perCPU)) for i, count := range perCPU { @@ -117,7 +117,7 @@ func parseSoftirqs(r io.Reader) (Softirqs, error) { return Softirqs{}, fmt.Errorf("%w: couldn't parse %q (IRQ_POLL%d): %w", ErrFileParse, count, i, err) } } - case parts[0] == "TASKLET:": + case "TASKLET:": perCPU := parts[1:] softirqs.Tasklet = make([]uint64, len(perCPU)) for i, count := range perCPU { @@ -125,7 +125,7 @@ func parseSoftirqs(r io.Reader) (Softirqs, error) { return Softirqs{}, fmt.Errorf("%w: couldn't parse %q (TASKLET%d): %w", ErrFileParse, count, i, err) } } - case parts[0] == "SCHED:": + case "SCHED:": perCPU := parts[1:] softirqs.Sched = make([]uint64, len(perCPU)) for i, count := range perCPU { @@ -133,7 +133,7 @@ func parseSoftirqs(r io.Reader) (Softirqs, error) { return Softirqs{}, fmt.Errorf("%w: couldn't parse %q (SCHED%d): %w", ErrFileParse, count, i, err) } } - case parts[0] == "HRTIMER:": + case "HRTIMER:": perCPU := parts[1:] softirqs.HRTimer = make([]uint64, len(perCPU)) for i, count := range perCPU { @@ -141,7 +141,7 @@ func parseSoftirqs(r io.Reader) (Softirqs, error) { return Softirqs{}, fmt.Errorf("%w: couldn't parse %q (HRTIMER%d): %w", ErrFileParse, count, i, err) } } - case parts[0] == "RCU:": + case "RCU:": perCPU := parts[1:] softirqs.RCU = make([]uint64, len(perCPU)) for i, count := range perCPU { diff --git a/vendor/github.com/spf13/afero/.editorconfig b/vendor/github.com/spf13/afero/.editorconfig new file mode 100644 index 00000000000..4492e9f9fe1 --- /dev/null +++ b/vendor/github.com/spf13/afero/.editorconfig @@ -0,0 +1,12 @@ +root = true + +[*] +charset = utf-8 +end_of_line = lf +indent_size = 4 +indent_style = space +insert_final_newline = true +trim_trailing_whitespace = true + +[*.go] +indent_style = tab diff --git a/vendor/github.com/spf13/afero/.golangci.yaml b/vendor/github.com/spf13/afero/.golangci.yaml new file mode 100644 index 00000000000..806289a2507 --- /dev/null +++ b/vendor/github.com/spf13/afero/.golangci.yaml @@ -0,0 +1,18 @@ +linters-settings: + gci: + sections: + - standard + - default + - prefix(github.com/spf13/afero) + +linters: + disable-all: true + enable: + - gci + - gofmt + - gofumpt + - staticcheck + +issues: + exclude-dirs: + - gcsfs/internal/stiface diff --git a/vendor/github.com/spf13/afero/README.md b/vendor/github.com/spf13/afero/README.md index 3bafbfdfcaf..86f1545543b 100644 --- a/vendor/github.com/spf13/afero/README.md +++ b/vendor/github.com/spf13/afero/README.md @@ -2,7 +2,11 @@ A FileSystem Abstraction System for Go -[![Test](https://github.com/spf13/afero/actions/workflows/test.yml/badge.svg)](https://github.com/spf13/afero/actions/workflows/test.yml) [![GoDoc](https://godoc.org/github.com/spf13/afero?status.svg)](https://godoc.org/github.com/spf13/afero) [![Join the chat at https://gitter.im/spf13/afero](https://badges.gitter.im/Dev%20Chat.svg)](https://gitter.im/spf13/afero?utm_source=badge&utm_medium=badge&utm_campaign=pr-badge&utm_content=badge) +[![GitHub Workflow Status](https://img.shields.io/github/actions/workflow/status/spf13/afero/ci.yaml?branch=master&style=flat-square)](https://github.com/spf13/afero/actions?query=workflow%3ACI) +[![Join the chat at https://gitter.im/spf13/afero](https://badges.gitter.im/Dev%20Chat.svg)](https://gitter.im/spf13/afero?utm_source=badge&utm_medium=badge&utm_campaign=pr-badge&utm_content=badge) +[![Go Report Card](https://goreportcard.com/badge/github.com/spf13/afero?style=flat-square)](https://goreportcard.com/report/github.com/spf13/afero) +![Go Version](https://img.shields.io/badge/go%20version-%3E=1.23-61CFDD.svg?style=flat-square) +[![PkgGoDev](https://pkg.go.dev/badge/mod/github.com/spf13/afero)](https://pkg.go.dev/mod/github.com/spf13/afero) # Overview @@ -12,7 +16,7 @@ types and methods. Afero has an exceptionally clean interface and simple design without needless constructors or initialization methods. Afero is also a library providing a base set of interoperable backend -filesystems that make it easy to work with afero while retaining all the power +filesystems that make it easy to work with, while retaining all the power and benefit of the os and ioutil packages. Afero provides significant improvements over using the os package alone, most @@ -427,6 +431,39 @@ See the [Releases Page](https://github.com/spf13/afero/releases). 4. Push to the branch (`git push origin my-new-feature`) 5. Create new Pull Request +## Releasing + +As of version 1.14.0, Afero moved implementations with third-party libraries to +their own submodules. + +Releasing a new version now requires a few steps: + +``` +VERSION=X.Y.Z +git tag -a v$VERSION -m "Release $VERSION" +git push origin v$VERSION + +cd gcsfs +go get github.com/spf13/afero@v$VERSION +go mod tidy +git commit -am "Update afero to v$VERSION" +git tag -a gcsfs/v$VERSION -m "Release gcsfs $VERSION" +git push origin gcsfs/v$VERSION +cd .. + +cd sftpfs +go get github.com/spf13/afero@v$VERSION +go mod tidy +git commit -am "Update afero to v$VERSION" +git tag -a sftpfs/v$VERSION -m "Release sftpfs $VERSION" +git push origin sftpfs/v$VERSION +cd .. + +git push +``` + +TODO: move these instructions to a Makefile or something + ## Contributors Names in no particular order: diff --git a/vendor/github.com/spf13/afero/iofs.go b/vendor/github.com/spf13/afero/iofs.go index 938b9316e6b..b13155ca4a9 100644 --- a/vendor/github.com/spf13/afero/iofs.go +++ b/vendor/github.com/spf13/afero/iofs.go @@ -255,7 +255,6 @@ func (f fromIOFSFile) Readdir(count int) ([]os.FileInfo, error) { ret := make([]os.FileInfo, len(entries)) for i := range entries { ret[i], err = entries[i].Info() - if err != nil { return nil, err } diff --git a/vendor/github.com/spf13/afero/memmap.go b/vendor/github.com/spf13/afero/memmap.go index d6c744e8d56..ed92f5649da 100644 --- a/vendor/github.com/spf13/afero/memmap.go +++ b/vendor/github.com/spf13/afero/memmap.go @@ -16,11 +16,9 @@ package afero import ( "fmt" "io" - "log" "os" "path/filepath" - "sort" "strings" "sync" diff --git a/vendor/github.com/tjhop/slog-gokit/README.md b/vendor/github.com/tjhop/slog-gokit/README.md index 6addd47981d..170d587566f 100644 --- a/vendor/github.com/tjhop/slog-gokit/README.md +++ b/vendor/github.com/tjhop/slog-gokit/README.md @@ -49,3 +49,13 @@ func main() { slogger.WithGroup("example_group").With("foo", "bar").Info("hello world") } ``` + +## Development + +Contributions are welcome! Commits should follow [conventional commits](https://www.conventionalcommits.org/en/v1.0.0/) syntax. + +### Required Software/Tools + +- Working Go environment +- Docker +- GNU Make diff --git a/vendor/github.com/tjhop/slog-gokit/handler.go b/vendor/github.com/tjhop/slog-gokit/handler.go index d2b84a647cd..23ca2d85a44 100644 --- a/vendor/github.com/tjhop/slog-gokit/handler.go +++ b/vendor/github.com/tjhop/slog-gokit/handler.go @@ -17,7 +17,7 @@ var defaultGoKitLogger = log.NewLogfmtLogger(os.Stderr) type GoKitHandler struct { level slog.Leveler logger log.Logger - preformatted []any + preformatted []slog.Attr group string } @@ -70,10 +70,14 @@ func (h *GoKitHandler) Handle(_ context.Context, record slog.Record) error { // creation time here. pairs := make([]any, 0, (2 * record.NumAttrs())) if !record.Time.IsZero() { - pairs = append(pairs, "time", record.Time) + pairs = append(pairs, slog.TimeKey, record.Time) + } + pairs = append(pairs, slog.MessageKey, record.Message) + + // preformatted attributes have already had their group prefix applied in WithAttr + for _, a := range h.preformatted { + pairs = appendPair(pairs, "", a) } - pairs = append(pairs, "msg", record.Message) - pairs = append(pairs, h.preformatted...) record.Attrs(func(a slog.Attr) bool { pairs = appendPair(pairs, h.group, a) @@ -86,9 +90,13 @@ func (h *GoKitHandler) Handle(_ context.Context, record slog.Record) error { // WithAttrs formats the provided attributes and caches them in the handler to // attach to all future log calls. It implements slog.Handler. func (h *GoKitHandler) WithAttrs(attrs []slog.Attr) slog.Handler { - pairs := make([]any, 0, 2*len(attrs)) - for _, a := range attrs { - pairs = appendPair(pairs, h.group, a) + pairs := make([]slog.Attr, 0, len(attrs)+len(h.preformatted)) + for _, attr := range attrs { + // preresolve the group to simplify attr tracking + if h.group != "" { + attr.Key = h.group + "." + attr.Key + } + pairs = append(pairs, attr) } if h.preformatted != nil { @@ -156,7 +164,7 @@ func appendPair(pairs []any, groupPrefix string, attr slog.Attr) []any { key = groupPrefix + "." + key } - pairs = append(pairs, key, attr.Value) + pairs = append(pairs, key, attr.Value.Resolve()) } return pairs diff --git a/vendor/go.etcd.io/etcd/api/v3/version/version.go b/vendor/go.etcd.io/etcd/api/v3/version/version.go index ca6efc51367..03449b523b6 100644 --- a/vendor/go.etcd.io/etcd/api/v3/version/version.go +++ b/vendor/go.etcd.io/etcd/api/v3/version/version.go @@ -26,7 +26,7 @@ import ( var ( // MinClusterVersion is the min cluster version this etcd binary is compatible with. MinClusterVersion = "3.0.0" - Version = "3.5.17" + Version = "3.5.21" APIVersion = "unknown" // Git SHA Value will be set during build diff --git a/vendor/go.etcd.io/etcd/client/v3/lease.go b/vendor/go.etcd.io/etcd/client/v3/lease.go index 4e7d1caf831..4877ee94962 100644 --- a/vendor/go.etcd.io/etcd/client/v3/lease.go +++ b/vendor/go.etcd.io/etcd/client/v3/lease.go @@ -263,6 +263,12 @@ func (l *lessor) Leases(ctx context.Context) (*LeaseLeasesResponse, error) { return nil, ContextError(ctx, err) } +// To identify the context passed to `KeepAlive`, a key/value pair is +// attached to the context. The key is a `keepAliveCtxKey` object, and +// the value is the pointer to the context object itself, ensuring +// uniqueness as each context has a unique memory address. +type keepAliveCtxKey struct{} + func (l *lessor) KeepAlive(ctx context.Context, id LeaseID) (<-chan *LeaseKeepAliveResponse, error) { ch := make(chan *LeaseKeepAliveResponse, LeaseResponseChSize) @@ -277,6 +283,10 @@ func (l *lessor) KeepAlive(ctx context.Context, id LeaseID) (<-chan *LeaseKeepAl default: } ka, ok := l.keepAlives[id] + + if ctx.Done() != nil { + ctx = context.WithValue(ctx, keepAliveCtxKey{}, &ctx) + } if !ok { // create fresh keep alive ka = &keepAlive{ @@ -347,7 +357,7 @@ func (l *lessor) keepAliveCtxCloser(ctx context.Context, id LeaseID, donec <-cha // close channel and remove context if still associated with keep alive for i, c := range ka.ctxs { - if c == ctx { + if c.Value(keepAliveCtxKey{}) == ctx.Value(keepAliveCtxKey{}) { close(ka.chs[i]) ka.ctxs = append(ka.ctxs[:i], ka.ctxs[i+1:]...) ka.chs = append(ka.chs[:i], ka.chs[i+1:]...) diff --git a/vendor/go.opentelemetry.io/collector/pdata/pcommon/generated_byteslice.go b/vendor/go.opentelemetry.io/collector/pdata/pcommon/generated_byteslice.go index cbb64987d2b..f730a185ca8 100644 --- a/vendor/go.opentelemetry.io/collector/pdata/pcommon/generated_byteslice.go +++ b/vendor/go.opentelemetry.io/collector/pdata/pcommon/generated_byteslice.go @@ -7,6 +7,9 @@ package pcommon import ( + "iter" + "slices" + "go.opentelemetry.io/collector/pdata/internal" ) @@ -55,6 +58,17 @@ func (ms ByteSlice) At(i int) byte { return (*ms.getOrig())[i] } +// All returns an iterator over index-value pairs in the slice. +func (ms ByteSlice) All() iter.Seq2[int, byte] { + return func(yield func(int, byte) bool) { + for i := 0; i < ms.Len(); i++ { + if !yield(i, ms.At(i)) { + return + } + } + } +} + // SetAt sets byte item at particular index. // Equivalent of byteSlice[i] = val func (ms ByteSlice) SetAt(i int, val byte) { @@ -102,6 +116,11 @@ func (ms ByteSlice) CopyTo(dest ByteSlice) { *dest.getOrig() = copyByteSlice(*dest.getOrig(), *ms.getOrig()) } +// Equal checks equality with another ByteSlice +func (ms ByteSlice) Equal(val ByteSlice) bool { + return slices.Equal(*ms.getOrig(), *val.getOrig()) +} + func copyByteSlice(dst, src []byte) []byte { dst = dst[:0] return append(dst, src...) diff --git a/vendor/go.opentelemetry.io/collector/pdata/pcommon/generated_float64slice.go b/vendor/go.opentelemetry.io/collector/pdata/pcommon/generated_float64slice.go index 83a07ccf483..7cd0a7b63a2 100644 --- a/vendor/go.opentelemetry.io/collector/pdata/pcommon/generated_float64slice.go +++ b/vendor/go.opentelemetry.io/collector/pdata/pcommon/generated_float64slice.go @@ -7,6 +7,9 @@ package pcommon import ( + "iter" + "slices" + "go.opentelemetry.io/collector/pdata/internal" ) @@ -55,6 +58,17 @@ func (ms Float64Slice) At(i int) float64 { return (*ms.getOrig())[i] } +// All returns an iterator over index-value pairs in the slice. +func (ms Float64Slice) All() iter.Seq2[int, float64] { + return func(yield func(int, float64) bool) { + for i := 0; i < ms.Len(); i++ { + if !yield(i, ms.At(i)) { + return + } + } + } +} + // SetAt sets float64 item at particular index. // Equivalent of float64Slice[i] = val func (ms Float64Slice) SetAt(i int, val float64) { @@ -102,6 +116,11 @@ func (ms Float64Slice) CopyTo(dest Float64Slice) { *dest.getOrig() = copyFloat64Slice(*dest.getOrig(), *ms.getOrig()) } +// Equal checks equality with another Float64Slice +func (ms Float64Slice) Equal(val Float64Slice) bool { + return slices.Equal(*ms.getOrig(), *val.getOrig()) +} + func copyFloat64Slice(dst, src []float64) []float64 { dst = dst[:0] return append(dst, src...) diff --git a/vendor/go.opentelemetry.io/collector/pdata/pcommon/generated_int32slice.go b/vendor/go.opentelemetry.io/collector/pdata/pcommon/generated_int32slice.go index 35a40bd079c..a8ac6a3b4f8 100644 --- a/vendor/go.opentelemetry.io/collector/pdata/pcommon/generated_int32slice.go +++ b/vendor/go.opentelemetry.io/collector/pdata/pcommon/generated_int32slice.go @@ -7,6 +7,9 @@ package pcommon import ( + "iter" + "slices" + "go.opentelemetry.io/collector/pdata/internal" ) @@ -55,6 +58,17 @@ func (ms Int32Slice) At(i int) int32 { return (*ms.getOrig())[i] } +// All returns an iterator over index-value pairs in the slice. +func (ms Int32Slice) All() iter.Seq2[int, int32] { + return func(yield func(int, int32) bool) { + for i := 0; i < ms.Len(); i++ { + if !yield(i, ms.At(i)) { + return + } + } + } +} + // SetAt sets int32 item at particular index. // Equivalent of int32Slice[i] = val func (ms Int32Slice) SetAt(i int, val int32) { @@ -102,6 +116,11 @@ func (ms Int32Slice) CopyTo(dest Int32Slice) { *dest.getOrig() = copyInt32Slice(*dest.getOrig(), *ms.getOrig()) } +// Equal checks equality with another Int32Slice +func (ms Int32Slice) Equal(val Int32Slice) bool { + return slices.Equal(*ms.getOrig(), *val.getOrig()) +} + func copyInt32Slice(dst, src []int32) []int32 { dst = dst[:0] return append(dst, src...) diff --git a/vendor/go.opentelemetry.io/collector/pdata/pcommon/generated_int64slice.go b/vendor/go.opentelemetry.io/collector/pdata/pcommon/generated_int64slice.go index e50cd3cc3a5..a8e5f453b75 100644 --- a/vendor/go.opentelemetry.io/collector/pdata/pcommon/generated_int64slice.go +++ b/vendor/go.opentelemetry.io/collector/pdata/pcommon/generated_int64slice.go @@ -7,6 +7,9 @@ package pcommon import ( + "iter" + "slices" + "go.opentelemetry.io/collector/pdata/internal" ) @@ -55,6 +58,17 @@ func (ms Int64Slice) At(i int) int64 { return (*ms.getOrig())[i] } +// All returns an iterator over index-value pairs in the slice. +func (ms Int64Slice) All() iter.Seq2[int, int64] { + return func(yield func(int, int64) bool) { + for i := 0; i < ms.Len(); i++ { + if !yield(i, ms.At(i)) { + return + } + } + } +} + // SetAt sets int64 item at particular index. // Equivalent of int64Slice[i] = val func (ms Int64Slice) SetAt(i int, val int64) { @@ -102,6 +116,11 @@ func (ms Int64Slice) CopyTo(dest Int64Slice) { *dest.getOrig() = copyInt64Slice(*dest.getOrig(), *ms.getOrig()) } +// Equal checks equality with another Int64Slice +func (ms Int64Slice) Equal(val Int64Slice) bool { + return slices.Equal(*ms.getOrig(), *val.getOrig()) +} + func copyInt64Slice(dst, src []int64) []int64 { dst = dst[:0] return append(dst, src...) diff --git a/vendor/go.opentelemetry.io/collector/pdata/pcommon/generated_stringslice.go b/vendor/go.opentelemetry.io/collector/pdata/pcommon/generated_stringslice.go index 02a75c7a65c..b165645708c 100644 --- a/vendor/go.opentelemetry.io/collector/pdata/pcommon/generated_stringslice.go +++ b/vendor/go.opentelemetry.io/collector/pdata/pcommon/generated_stringslice.go @@ -7,6 +7,9 @@ package pcommon import ( + "iter" + "slices" + "go.opentelemetry.io/collector/pdata/internal" ) @@ -55,6 +58,17 @@ func (ms StringSlice) At(i int) string { return (*ms.getOrig())[i] } +// All returns an iterator over index-value pairs in the slice. +func (ms StringSlice) All() iter.Seq2[int, string] { + return func(yield func(int, string) bool) { + for i := 0; i < ms.Len(); i++ { + if !yield(i, ms.At(i)) { + return + } + } + } +} + // SetAt sets string item at particular index. // Equivalent of stringSlice[i] = val func (ms StringSlice) SetAt(i int, val string) { @@ -102,6 +116,11 @@ func (ms StringSlice) CopyTo(dest StringSlice) { *dest.getOrig() = copyStringSlice(*dest.getOrig(), *ms.getOrig()) } +// Equal checks equality with another StringSlice +func (ms StringSlice) Equal(val StringSlice) bool { + return slices.Equal(*ms.getOrig(), *val.getOrig()) +} + func copyStringSlice(dst, src []string) []string { dst = dst[:0] return append(dst, src...) diff --git a/vendor/go.opentelemetry.io/collector/pdata/pcommon/generated_uint64slice.go b/vendor/go.opentelemetry.io/collector/pdata/pcommon/generated_uint64slice.go index 1344ca35bcf..937d64e4a40 100644 --- a/vendor/go.opentelemetry.io/collector/pdata/pcommon/generated_uint64slice.go +++ b/vendor/go.opentelemetry.io/collector/pdata/pcommon/generated_uint64slice.go @@ -7,6 +7,9 @@ package pcommon import ( + "iter" + "slices" + "go.opentelemetry.io/collector/pdata/internal" ) @@ -55,6 +58,17 @@ func (ms UInt64Slice) At(i int) uint64 { return (*ms.getOrig())[i] } +// All returns an iterator over index-value pairs in the slice. +func (ms UInt64Slice) All() iter.Seq2[int, uint64] { + return func(yield func(int, uint64) bool) { + for i := 0; i < ms.Len(); i++ { + if !yield(i, ms.At(i)) { + return + } + } + } +} + // SetAt sets uint64 item at particular index. // Equivalent of uInt64Slice[i] = val func (ms UInt64Slice) SetAt(i int, val uint64) { @@ -102,6 +116,11 @@ func (ms UInt64Slice) CopyTo(dest UInt64Slice) { *dest.getOrig() = copyUInt64Slice(*dest.getOrig(), *ms.getOrig()) } +// Equal checks equality with another UInt64Slice +func (ms UInt64Slice) Equal(val UInt64Slice) bool { + return slices.Equal(*ms.getOrig(), *val.getOrig()) +} + func copyUInt64Slice(dst, src []uint64) []uint64 { dst = dst[:0] return append(dst, src...) diff --git a/vendor/go.opentelemetry.io/collector/pdata/pcommon/map.go b/vendor/go.opentelemetry.io/collector/pdata/pcommon/map.go index 91b803922a3..ccbf3a55d73 100644 --- a/vendor/go.opentelemetry.io/collector/pdata/pcommon/map.go +++ b/vendor/go.opentelemetry.io/collector/pdata/pcommon/map.go @@ -4,6 +4,8 @@ package pcommon // import "go.opentelemetry.io/collector/pdata/pcommon" import ( + "iter" + "go.uber.org/multierr" "go.opentelemetry.io/collector/pdata/internal" @@ -225,6 +227,22 @@ func (m Map) Range(f func(k string, v Value) bool) { } } +// All returns an iterator over key-value pairs in the Map. +// +// for k, v := range es.All() { +// ... // Do something with key-value pair +// } +func (m Map) All() iter.Seq2[string, Value] { + return func(yield func(string, Value) bool) { + for i := range *m.getOrig() { + kv := &(*m.getOrig())[i] + if !yield(kv.Key, Value(internal.NewValue(&kv.Value, m.getState()))) { + return + } + } + } +} + // MoveTo moves all key/values from the current map overriding the destination and // resetting the current instance to its zero value func (m Map) MoveTo(dest Map) { @@ -263,7 +281,7 @@ func (m Map) CopyTo(dest Map) { // AsRaw returns a standard go map representation of this Map. func (m Map) AsRaw() map[string]any { - rawMap := make(map[string]any) + rawMap := make(map[string]any, m.Len()) m.Range(func(k string, v Value) bool { rawMap[k] = v.AsRaw() return true @@ -290,3 +308,26 @@ func (m Map) FromRaw(rawMap map[string]any) error { *m.getOrig() = origs return errs } + +// Equal checks equality with another Map +func (m Map) Equal(val Map) bool { + if m.Len() != val.Len() { + return false + } + + fullEqual := true + + m.Range(func(k string, v Value) bool { + vv, ok := val.Get(k) + if !ok { + fullEqual = false + return fullEqual + } + + if !v.Equal(vv) { + fullEqual = false + } + return fullEqual + }) + return fullEqual +} diff --git a/vendor/go.opentelemetry.io/collector/pdata/pcommon/slice.go b/vendor/go.opentelemetry.io/collector/pdata/pcommon/slice.go index 7434f467aed..7e8037df322 100644 --- a/vendor/go.opentelemetry.io/collector/pdata/pcommon/slice.go +++ b/vendor/go.opentelemetry.io/collector/pdata/pcommon/slice.go @@ -4,6 +4,8 @@ package pcommon // import "go.opentelemetry.io/collector/pdata/pcommon" import ( + "iter" + "go.uber.org/multierr" "go.opentelemetry.io/collector/pdata/internal" @@ -58,6 +60,21 @@ func (es Slice) At(ix int) Value { return newValue(&(*es.getOrig())[ix], es.getState()) } +// All returns an iterator over index-value pairs in the slice. +// +// for i, v := range es.All() { +// ... // Do something with index-value pair +// } +func (es Slice) All() iter.Seq2[int, Value] { + return func(yield func(int, Value) bool) { + for i := 0; i < es.Len(); i++ { + if !yield(i, es.At(i)) { + return + } + } + } +} + // CopyTo copies all elements from the current slice overriding the destination. func (es Slice) CopyTo(dest Slice) { dest.getState().AssertMutable() @@ -164,3 +181,17 @@ func (es Slice) FromRaw(rawSlice []any) error { *es.getOrig() = origs return errs } + +// Equal checks equality with another Slice +func (es Slice) Equal(val Slice) bool { + if es.Len() != val.Len() { + return false + } + + for i := 0; i < es.Len(); i++ { + if !es.At(i).Equal(val.At(i)) { + return false + } + } + return true +} diff --git a/vendor/go.opentelemetry.io/collector/pdata/pcommon/timestamp.go b/vendor/go.opentelemetry.io/collector/pdata/pcommon/timestamp.go index 666f86f43f6..037213a0caf 100644 --- a/vendor/go.opentelemetry.io/collector/pdata/pcommon/timestamp.go +++ b/vendor/go.opentelemetry.io/collector/pdata/pcommon/timestamp.go @@ -13,13 +13,13 @@ type Timestamp uint64 // NewTimestampFromTime constructs a new Timestamp from the provided time.Time. func NewTimestampFromTime(t time.Time) Timestamp { - // nolint:gosec + //nolint:gosec return Timestamp(uint64(t.UnixNano())) } // AsTime converts this to a time.Time. func (ts Timestamp) AsTime() time.Time { - // nolint:gosec + //nolint:gosec return time.Unix(0, int64(ts)).UTC() } diff --git a/vendor/go.opentelemetry.io/collector/pdata/pcommon/value.go b/vendor/go.opentelemetry.io/collector/pdata/pcommon/value.go index ad2e1c7ae47..5c7972ced87 100644 --- a/vendor/go.opentelemetry.io/collector/pdata/pcommon/value.go +++ b/vendor/go.opentelemetry.io/collector/pdata/pcommon/value.go @@ -148,7 +148,7 @@ func (v Value) FromRaw(iv any) error { case int64: v.SetInt(tv) case uint: - // nolint:gosec + //nolint:gosec v.SetInt(int64(tv)) case uint8: v.SetInt(int64(tv)) @@ -157,7 +157,7 @@ func (v Value) FromRaw(iv any) error { case uint32: v.SetInt(int64(tv)) case uint64: - // nolint:gosec + //nolint:gosec v.SetInt(int64(tv)) case float32: v.SetDouble(float64(tv)) @@ -452,6 +452,33 @@ func (v Value) AsRaw() any { return fmt.Sprintf("", v.Type()) } +func (v Value) Equal(c Value) bool { + if v.Type() != c.Type() { + return false + } + + switch v.Type() { + case ValueTypeEmpty: + return true + case ValueTypeStr: + return v.Str() == c.Str() + case ValueTypeBool: + return v.Bool() == c.Bool() + case ValueTypeDouble: + return v.Double() == c.Double() + case ValueTypeInt: + return v.Int() == c.Int() + case ValueTypeBytes: + return v.Bytes().Equal(c.Bytes()) + case ValueTypeMap: + return v.Map().Equal(c.Map()) + case ValueTypeSlice: + return v.Slice().Equal(c.Slice()) + } + + return false +} + func newKeyValueString(k string, v string) otlpcommon.KeyValue { orig := otlpcommon.KeyValue{Key: k} state := internal.StateMutable diff --git a/vendor/go.opentelemetry.io/collector/pdata/plog/generated_logrecordslice.go b/vendor/go.opentelemetry.io/collector/pdata/plog/generated_logrecordslice.go index a900b4e1c7e..771233711c0 100644 --- a/vendor/go.opentelemetry.io/collector/pdata/plog/generated_logrecordslice.go +++ b/vendor/go.opentelemetry.io/collector/pdata/plog/generated_logrecordslice.go @@ -7,6 +7,7 @@ package plog import ( + "iter" "sort" "go.opentelemetry.io/collector/pdata/internal" @@ -56,6 +57,21 @@ func (es LogRecordSlice) At(i int) LogRecord { return newLogRecord((*es.orig)[i], es.state) } +// All returns an iterator over index-value pairs in the slice. +// +// for i, v := range es.All() { +// ... // Do something with index-value pair +// } +func (es LogRecordSlice) All() iter.Seq2[int, LogRecord] { + return func(yield func(int, LogRecord) bool) { + for i := 0; i < es.Len(); i++ { + if !yield(i, es.At(i)) { + return + } + } + } +} + // EnsureCapacity is an operation that ensures the slice has at least the specified capacity. // 1. If the newCap <= cap then no change in capacity. // 2. If the newCap > cap then the slice capacity will be expanded to equal newCap. diff --git a/vendor/go.opentelemetry.io/collector/pdata/plog/generated_resourcelogsslice.go b/vendor/go.opentelemetry.io/collector/pdata/plog/generated_resourcelogsslice.go index d2fc54de80b..3e574539ed5 100644 --- a/vendor/go.opentelemetry.io/collector/pdata/plog/generated_resourcelogsslice.go +++ b/vendor/go.opentelemetry.io/collector/pdata/plog/generated_resourcelogsslice.go @@ -7,6 +7,7 @@ package plog import ( + "iter" "sort" "go.opentelemetry.io/collector/pdata/internal" @@ -56,6 +57,21 @@ func (es ResourceLogsSlice) At(i int) ResourceLogs { return newResourceLogs((*es.orig)[i], es.state) } +// All returns an iterator over index-value pairs in the slice. +// +// for i, v := range es.All() { +// ... // Do something with index-value pair +// } +func (es ResourceLogsSlice) All() iter.Seq2[int, ResourceLogs] { + return func(yield func(int, ResourceLogs) bool) { + for i := 0; i < es.Len(); i++ { + if !yield(i, es.At(i)) { + return + } + } + } +} + // EnsureCapacity is an operation that ensures the slice has at least the specified capacity. // 1. If the newCap <= cap then no change in capacity. // 2. If the newCap > cap then the slice capacity will be expanded to equal newCap. diff --git a/vendor/go.opentelemetry.io/collector/pdata/plog/generated_scopelogsslice.go b/vendor/go.opentelemetry.io/collector/pdata/plog/generated_scopelogsslice.go index 5bae8d9f9c9..b4791995846 100644 --- a/vendor/go.opentelemetry.io/collector/pdata/plog/generated_scopelogsslice.go +++ b/vendor/go.opentelemetry.io/collector/pdata/plog/generated_scopelogsslice.go @@ -7,6 +7,7 @@ package plog import ( + "iter" "sort" "go.opentelemetry.io/collector/pdata/internal" @@ -56,6 +57,21 @@ func (es ScopeLogsSlice) At(i int) ScopeLogs { return newScopeLogs((*es.orig)[i], es.state) } +// All returns an iterator over index-value pairs in the slice. +// +// for i, v := range es.All() { +// ... // Do something with index-value pair +// } +func (es ScopeLogsSlice) All() iter.Seq2[int, ScopeLogs] { + return func(yield func(int, ScopeLogs) bool) { + for i := 0; i < es.Len(); i++ { + if !yield(i, es.At(i)) { + return + } + } + } +} + // EnsureCapacity is an operation that ensures the slice has at least the specified capacity. // 1. If the newCap <= cap then no change in capacity. // 2. If the newCap > cap then the slice capacity will be expanded to equal newCap. diff --git a/vendor/go.opentelemetry.io/collector/pdata/plog/pb.go b/vendor/go.opentelemetry.io/collector/pdata/plog/pb.go index bb102591bf2..a4cb09eb6ea 100644 --- a/vendor/go.opentelemetry.io/collector/pdata/plog/pb.go +++ b/vendor/go.opentelemetry.io/collector/pdata/plog/pb.go @@ -22,6 +22,18 @@ func (e *ProtoMarshaler) LogsSize(ld Logs) int { return pb.Size() } +func (e *ProtoMarshaler) ResourceLogsSize(rl ResourceLogs) int { + return rl.orig.Size() +} + +func (e *ProtoMarshaler) ScopeLogsSize(sl ScopeLogs) int { + return sl.orig.Size() +} + +func (e *ProtoMarshaler) LogRecordSize(lr LogRecord) int { + return lr.orig.Size() +} + var _ Unmarshaler = (*ProtoUnmarshaler)(nil) type ProtoUnmarshaler struct{} diff --git a/vendor/go.opentelemetry.io/collector/pdata/pmetric/generated_exemplarslice.go b/vendor/go.opentelemetry.io/collector/pdata/pmetric/generated_exemplarslice.go index 15d70a6edeb..4ee31367fc4 100644 --- a/vendor/go.opentelemetry.io/collector/pdata/pmetric/generated_exemplarslice.go +++ b/vendor/go.opentelemetry.io/collector/pdata/pmetric/generated_exemplarslice.go @@ -7,6 +7,8 @@ package pmetric import ( + "iter" + "go.opentelemetry.io/collector/pdata/internal" otlpmetrics "go.opentelemetry.io/collector/pdata/internal/data/protogen/metrics/v1" ) @@ -54,6 +56,21 @@ func (es ExemplarSlice) At(i int) Exemplar { return newExemplar(&(*es.orig)[i], es.state) } +// All returns an iterator over index-value pairs in the slice. +// +// for i, v := range es.All() { +// ... // Do something with index-value pair +// } +func (es ExemplarSlice) All() iter.Seq2[int, Exemplar] { + return func(yield func(int, Exemplar) bool) { + for i := 0; i < es.Len(); i++ { + if !yield(i, es.At(i)) { + return + } + } + } +} + // EnsureCapacity is an operation that ensures the slice has at least the specified capacity. // 1. If the newCap <= cap then no change in capacity. // 2. If the newCap > cap then the slice capacity will be expanded to equal newCap. diff --git a/vendor/go.opentelemetry.io/collector/pdata/pmetric/generated_exponentialhistogramdatapointslice.go b/vendor/go.opentelemetry.io/collector/pdata/pmetric/generated_exponentialhistogramdatapointslice.go index a466a7c185b..e37ccd9b67b 100644 --- a/vendor/go.opentelemetry.io/collector/pdata/pmetric/generated_exponentialhistogramdatapointslice.go +++ b/vendor/go.opentelemetry.io/collector/pdata/pmetric/generated_exponentialhistogramdatapointslice.go @@ -7,6 +7,7 @@ package pmetric import ( + "iter" "sort" "go.opentelemetry.io/collector/pdata/internal" @@ -56,6 +57,21 @@ func (es ExponentialHistogramDataPointSlice) At(i int) ExponentialHistogramDataP return newExponentialHistogramDataPoint((*es.orig)[i], es.state) } +// All returns an iterator over index-value pairs in the slice. +// +// for i, v := range es.All() { +// ... // Do something with index-value pair +// } +func (es ExponentialHistogramDataPointSlice) All() iter.Seq2[int, ExponentialHistogramDataPoint] { + return func(yield func(int, ExponentialHistogramDataPoint) bool) { + for i := 0; i < es.Len(); i++ { + if !yield(i, es.At(i)) { + return + } + } + } +} + // EnsureCapacity is an operation that ensures the slice has at least the specified capacity. // 1. If the newCap <= cap then no change in capacity. // 2. If the newCap > cap then the slice capacity will be expanded to equal newCap. diff --git a/vendor/go.opentelemetry.io/collector/pdata/pmetric/generated_histogramdatapointslice.go b/vendor/go.opentelemetry.io/collector/pdata/pmetric/generated_histogramdatapointslice.go index 7ee6ef737f8..ac9e4967109 100644 --- a/vendor/go.opentelemetry.io/collector/pdata/pmetric/generated_histogramdatapointslice.go +++ b/vendor/go.opentelemetry.io/collector/pdata/pmetric/generated_histogramdatapointslice.go @@ -7,6 +7,7 @@ package pmetric import ( + "iter" "sort" "go.opentelemetry.io/collector/pdata/internal" @@ -56,6 +57,21 @@ func (es HistogramDataPointSlice) At(i int) HistogramDataPoint { return newHistogramDataPoint((*es.orig)[i], es.state) } +// All returns an iterator over index-value pairs in the slice. +// +// for i, v := range es.All() { +// ... // Do something with index-value pair +// } +func (es HistogramDataPointSlice) All() iter.Seq2[int, HistogramDataPoint] { + return func(yield func(int, HistogramDataPoint) bool) { + for i := 0; i < es.Len(); i++ { + if !yield(i, es.At(i)) { + return + } + } + } +} + // EnsureCapacity is an operation that ensures the slice has at least the specified capacity. // 1. If the newCap <= cap then no change in capacity. // 2. If the newCap > cap then the slice capacity will be expanded to equal newCap. diff --git a/vendor/go.opentelemetry.io/collector/pdata/pmetric/generated_metricslice.go b/vendor/go.opentelemetry.io/collector/pdata/pmetric/generated_metricslice.go index 13f05a0ecbc..bf77dbaf77d 100644 --- a/vendor/go.opentelemetry.io/collector/pdata/pmetric/generated_metricslice.go +++ b/vendor/go.opentelemetry.io/collector/pdata/pmetric/generated_metricslice.go @@ -7,6 +7,7 @@ package pmetric import ( + "iter" "sort" "go.opentelemetry.io/collector/pdata/internal" @@ -56,6 +57,21 @@ func (es MetricSlice) At(i int) Metric { return newMetric((*es.orig)[i], es.state) } +// All returns an iterator over index-value pairs in the slice. +// +// for i, v := range es.All() { +// ... // Do something with index-value pair +// } +func (es MetricSlice) All() iter.Seq2[int, Metric] { + return func(yield func(int, Metric) bool) { + for i := 0; i < es.Len(); i++ { + if !yield(i, es.At(i)) { + return + } + } + } +} + // EnsureCapacity is an operation that ensures the slice has at least the specified capacity. // 1. If the newCap <= cap then no change in capacity. // 2. If the newCap > cap then the slice capacity will be expanded to equal newCap. diff --git a/vendor/go.opentelemetry.io/collector/pdata/pmetric/generated_numberdatapointslice.go b/vendor/go.opentelemetry.io/collector/pdata/pmetric/generated_numberdatapointslice.go index 57cdd11743e..89a82d28297 100644 --- a/vendor/go.opentelemetry.io/collector/pdata/pmetric/generated_numberdatapointslice.go +++ b/vendor/go.opentelemetry.io/collector/pdata/pmetric/generated_numberdatapointslice.go @@ -7,6 +7,7 @@ package pmetric import ( + "iter" "sort" "go.opentelemetry.io/collector/pdata/internal" @@ -56,6 +57,21 @@ func (es NumberDataPointSlice) At(i int) NumberDataPoint { return newNumberDataPoint((*es.orig)[i], es.state) } +// All returns an iterator over index-value pairs in the slice. +// +// for i, v := range es.All() { +// ... // Do something with index-value pair +// } +func (es NumberDataPointSlice) All() iter.Seq2[int, NumberDataPoint] { + return func(yield func(int, NumberDataPoint) bool) { + for i := 0; i < es.Len(); i++ { + if !yield(i, es.At(i)) { + return + } + } + } +} + // EnsureCapacity is an operation that ensures the slice has at least the specified capacity. // 1. If the newCap <= cap then no change in capacity. // 2. If the newCap > cap then the slice capacity will be expanded to equal newCap. diff --git a/vendor/go.opentelemetry.io/collector/pdata/pmetric/generated_resourcemetricsslice.go b/vendor/go.opentelemetry.io/collector/pdata/pmetric/generated_resourcemetricsslice.go index 55217ea27d5..a8605660c77 100644 --- a/vendor/go.opentelemetry.io/collector/pdata/pmetric/generated_resourcemetricsslice.go +++ b/vendor/go.opentelemetry.io/collector/pdata/pmetric/generated_resourcemetricsslice.go @@ -7,6 +7,7 @@ package pmetric import ( + "iter" "sort" "go.opentelemetry.io/collector/pdata/internal" @@ -56,6 +57,21 @@ func (es ResourceMetricsSlice) At(i int) ResourceMetrics { return newResourceMetrics((*es.orig)[i], es.state) } +// All returns an iterator over index-value pairs in the slice. +// +// for i, v := range es.All() { +// ... // Do something with index-value pair +// } +func (es ResourceMetricsSlice) All() iter.Seq2[int, ResourceMetrics] { + return func(yield func(int, ResourceMetrics) bool) { + for i := 0; i < es.Len(); i++ { + if !yield(i, es.At(i)) { + return + } + } + } +} + // EnsureCapacity is an operation that ensures the slice has at least the specified capacity. // 1. If the newCap <= cap then no change in capacity. // 2. If the newCap > cap then the slice capacity will be expanded to equal newCap. diff --git a/vendor/go.opentelemetry.io/collector/pdata/pmetric/generated_scopemetricsslice.go b/vendor/go.opentelemetry.io/collector/pdata/pmetric/generated_scopemetricsslice.go index a86eb0b4815..9514a30301c 100644 --- a/vendor/go.opentelemetry.io/collector/pdata/pmetric/generated_scopemetricsslice.go +++ b/vendor/go.opentelemetry.io/collector/pdata/pmetric/generated_scopemetricsslice.go @@ -7,6 +7,7 @@ package pmetric import ( + "iter" "sort" "go.opentelemetry.io/collector/pdata/internal" @@ -56,6 +57,21 @@ func (es ScopeMetricsSlice) At(i int) ScopeMetrics { return newScopeMetrics((*es.orig)[i], es.state) } +// All returns an iterator over index-value pairs in the slice. +// +// for i, v := range es.All() { +// ... // Do something with index-value pair +// } +func (es ScopeMetricsSlice) All() iter.Seq2[int, ScopeMetrics] { + return func(yield func(int, ScopeMetrics) bool) { + for i := 0; i < es.Len(); i++ { + if !yield(i, es.At(i)) { + return + } + } + } +} + // EnsureCapacity is an operation that ensures the slice has at least the specified capacity. // 1. If the newCap <= cap then no change in capacity. // 2. If the newCap > cap then the slice capacity will be expanded to equal newCap. diff --git a/vendor/go.opentelemetry.io/collector/pdata/pmetric/generated_summarydatapointslice.go b/vendor/go.opentelemetry.io/collector/pdata/pmetric/generated_summarydatapointslice.go index f915500963f..2ff9ceb0c09 100644 --- a/vendor/go.opentelemetry.io/collector/pdata/pmetric/generated_summarydatapointslice.go +++ b/vendor/go.opentelemetry.io/collector/pdata/pmetric/generated_summarydatapointslice.go @@ -7,6 +7,7 @@ package pmetric import ( + "iter" "sort" "go.opentelemetry.io/collector/pdata/internal" @@ -56,6 +57,21 @@ func (es SummaryDataPointSlice) At(i int) SummaryDataPoint { return newSummaryDataPoint((*es.orig)[i], es.state) } +// All returns an iterator over index-value pairs in the slice. +// +// for i, v := range es.All() { +// ... // Do something with index-value pair +// } +func (es SummaryDataPointSlice) All() iter.Seq2[int, SummaryDataPoint] { + return func(yield func(int, SummaryDataPoint) bool) { + for i := 0; i < es.Len(); i++ { + if !yield(i, es.At(i)) { + return + } + } + } +} + // EnsureCapacity is an operation that ensures the slice has at least the specified capacity. // 1. If the newCap <= cap then no change in capacity. // 2. If the newCap > cap then the slice capacity will be expanded to equal newCap. diff --git a/vendor/go.opentelemetry.io/collector/pdata/pmetric/generated_summarydatapointvalueatquantileslice.go b/vendor/go.opentelemetry.io/collector/pdata/pmetric/generated_summarydatapointvalueatquantileslice.go index ed899050ac6..6a82f5d906d 100644 --- a/vendor/go.opentelemetry.io/collector/pdata/pmetric/generated_summarydatapointvalueatquantileslice.go +++ b/vendor/go.opentelemetry.io/collector/pdata/pmetric/generated_summarydatapointvalueatquantileslice.go @@ -7,6 +7,7 @@ package pmetric import ( + "iter" "sort" "go.opentelemetry.io/collector/pdata/internal" @@ -56,6 +57,21 @@ func (es SummaryDataPointValueAtQuantileSlice) At(i int) SummaryDataPointValueAt return newSummaryDataPointValueAtQuantile((*es.orig)[i], es.state) } +// All returns an iterator over index-value pairs in the slice. +// +// for i, v := range es.All() { +// ... // Do something with index-value pair +// } +func (es SummaryDataPointValueAtQuantileSlice) All() iter.Seq2[int, SummaryDataPointValueAtQuantile] { + return func(yield func(int, SummaryDataPointValueAtQuantile) bool) { + for i := 0; i < es.Len(); i++ { + if !yield(i, es.At(i)) { + return + } + } + } +} + // EnsureCapacity is an operation that ensures the slice has at least the specified capacity. // 1. If the newCap <= cap then no change in capacity. // 2. If the newCap > cap then the slice capacity will be expanded to equal newCap. diff --git a/vendor/go.opentelemetry.io/collector/pdata/pmetric/pb.go b/vendor/go.opentelemetry.io/collector/pdata/pmetric/pb.go index 580f555d7a9..775a96f6a7e 100644 --- a/vendor/go.opentelemetry.io/collector/pdata/pmetric/pb.go +++ b/vendor/go.opentelemetry.io/collector/pdata/pmetric/pb.go @@ -22,6 +22,34 @@ func (e *ProtoMarshaler) MetricsSize(md Metrics) int { return pb.Size() } +func (e *ProtoMarshaler) ResourceMetricsSize(rm ResourceMetrics) int { + return rm.orig.Size() +} + +func (e *ProtoMarshaler) ScopeMetricsSize(sm ScopeMetrics) int { + return sm.orig.Size() +} + +func (e *ProtoMarshaler) MetricSize(m Metric) int { + return m.orig.Size() +} + +func (e *ProtoMarshaler) NumberDataPointSize(ndp NumberDataPoint) int { + return ndp.orig.Size() +} + +func (e *ProtoMarshaler) SummaryDataPointSize(sdps SummaryDataPoint) int { + return sdps.orig.Size() +} + +func (e *ProtoMarshaler) HistogramDataPointSize(hdp HistogramDataPoint) int { + return hdp.orig.Size() +} + +func (e *ProtoMarshaler) ExponentialHistogramDataPointSize(ehdp ExponentialHistogramDataPoint) int { + return ehdp.orig.Size() +} + type ProtoUnmarshaler struct{} func (d *ProtoUnmarshaler) UnmarshalMetrics(buf []byte) (Metrics, error) { diff --git a/vendor/go.opentelemetry.io/collector/pdata/ptrace/generated_resourcespansslice.go b/vendor/go.opentelemetry.io/collector/pdata/ptrace/generated_resourcespansslice.go index da79ef4a342..351978c78fd 100644 --- a/vendor/go.opentelemetry.io/collector/pdata/ptrace/generated_resourcespansslice.go +++ b/vendor/go.opentelemetry.io/collector/pdata/ptrace/generated_resourcespansslice.go @@ -7,6 +7,7 @@ package ptrace import ( + "iter" "sort" "go.opentelemetry.io/collector/pdata/internal" @@ -56,6 +57,21 @@ func (es ResourceSpansSlice) At(i int) ResourceSpans { return newResourceSpans((*es.orig)[i], es.state) } +// All returns an iterator over index-value pairs in the slice. +// +// for i, v := range es.All() { +// ... // Do something with index-value pair +// } +func (es ResourceSpansSlice) All() iter.Seq2[int, ResourceSpans] { + return func(yield func(int, ResourceSpans) bool) { + for i := 0; i < es.Len(); i++ { + if !yield(i, es.At(i)) { + return + } + } + } +} + // EnsureCapacity is an operation that ensures the slice has at least the specified capacity. // 1. If the newCap <= cap then no change in capacity. // 2. If the newCap > cap then the slice capacity will be expanded to equal newCap. diff --git a/vendor/go.opentelemetry.io/collector/pdata/ptrace/generated_scopespansslice.go b/vendor/go.opentelemetry.io/collector/pdata/ptrace/generated_scopespansslice.go index 8fd0b4b8e99..0050b917959 100644 --- a/vendor/go.opentelemetry.io/collector/pdata/ptrace/generated_scopespansslice.go +++ b/vendor/go.opentelemetry.io/collector/pdata/ptrace/generated_scopespansslice.go @@ -7,6 +7,7 @@ package ptrace import ( + "iter" "sort" "go.opentelemetry.io/collector/pdata/internal" @@ -56,6 +57,21 @@ func (es ScopeSpansSlice) At(i int) ScopeSpans { return newScopeSpans((*es.orig)[i], es.state) } +// All returns an iterator over index-value pairs in the slice. +// +// for i, v := range es.All() { +// ... // Do something with index-value pair +// } +func (es ScopeSpansSlice) All() iter.Seq2[int, ScopeSpans] { + return func(yield func(int, ScopeSpans) bool) { + for i := 0; i < es.Len(); i++ { + if !yield(i, es.At(i)) { + return + } + } + } +} + // EnsureCapacity is an operation that ensures the slice has at least the specified capacity. // 1. If the newCap <= cap then no change in capacity. // 2. If the newCap > cap then the slice capacity will be expanded to equal newCap. diff --git a/vendor/go.opentelemetry.io/collector/pdata/ptrace/generated_spaneventslice.go b/vendor/go.opentelemetry.io/collector/pdata/ptrace/generated_spaneventslice.go index ffde17c83a2..bed84fe0bce 100644 --- a/vendor/go.opentelemetry.io/collector/pdata/ptrace/generated_spaneventslice.go +++ b/vendor/go.opentelemetry.io/collector/pdata/ptrace/generated_spaneventslice.go @@ -7,6 +7,7 @@ package ptrace import ( + "iter" "sort" "go.opentelemetry.io/collector/pdata/internal" @@ -56,6 +57,21 @@ func (es SpanEventSlice) At(i int) SpanEvent { return newSpanEvent((*es.orig)[i], es.state) } +// All returns an iterator over index-value pairs in the slice. +// +// for i, v := range es.All() { +// ... // Do something with index-value pair +// } +func (es SpanEventSlice) All() iter.Seq2[int, SpanEvent] { + return func(yield func(int, SpanEvent) bool) { + for i := 0; i < es.Len(); i++ { + if !yield(i, es.At(i)) { + return + } + } + } +} + // EnsureCapacity is an operation that ensures the slice has at least the specified capacity. // 1. If the newCap <= cap then no change in capacity. // 2. If the newCap > cap then the slice capacity will be expanded to equal newCap. diff --git a/vendor/go.opentelemetry.io/collector/pdata/ptrace/generated_spanlinkslice.go b/vendor/go.opentelemetry.io/collector/pdata/ptrace/generated_spanlinkslice.go index 164038b8bed..79a8ad3bc51 100644 --- a/vendor/go.opentelemetry.io/collector/pdata/ptrace/generated_spanlinkslice.go +++ b/vendor/go.opentelemetry.io/collector/pdata/ptrace/generated_spanlinkslice.go @@ -7,6 +7,7 @@ package ptrace import ( + "iter" "sort" "go.opentelemetry.io/collector/pdata/internal" @@ -56,6 +57,21 @@ func (es SpanLinkSlice) At(i int) SpanLink { return newSpanLink((*es.orig)[i], es.state) } +// All returns an iterator over index-value pairs in the slice. +// +// for i, v := range es.All() { +// ... // Do something with index-value pair +// } +func (es SpanLinkSlice) All() iter.Seq2[int, SpanLink] { + return func(yield func(int, SpanLink) bool) { + for i := 0; i < es.Len(); i++ { + if !yield(i, es.At(i)) { + return + } + } + } +} + // EnsureCapacity is an operation that ensures the slice has at least the specified capacity. // 1. If the newCap <= cap then no change in capacity. // 2. If the newCap > cap then the slice capacity will be expanded to equal newCap. diff --git a/vendor/go.opentelemetry.io/collector/pdata/ptrace/generated_spanslice.go b/vendor/go.opentelemetry.io/collector/pdata/ptrace/generated_spanslice.go index 654a547523f..e250b8a4acd 100644 --- a/vendor/go.opentelemetry.io/collector/pdata/ptrace/generated_spanslice.go +++ b/vendor/go.opentelemetry.io/collector/pdata/ptrace/generated_spanslice.go @@ -7,6 +7,7 @@ package ptrace import ( + "iter" "sort" "go.opentelemetry.io/collector/pdata/internal" @@ -56,6 +57,21 @@ func (es SpanSlice) At(i int) Span { return newSpan((*es.orig)[i], es.state) } +// All returns an iterator over index-value pairs in the slice. +// +// for i, v := range es.All() { +// ... // Do something with index-value pair +// } +func (es SpanSlice) All() iter.Seq2[int, Span] { + return func(yield func(int, Span) bool) { + for i := 0; i < es.Len(); i++ { + if !yield(i, es.At(i)) { + return + } + } + } +} + // EnsureCapacity is an operation that ensures the slice has at least the specified capacity. // 1. If the newCap <= cap then no change in capacity. // 2. If the newCap > cap then the slice capacity will be expanded to equal newCap. diff --git a/vendor/go.opentelemetry.io/collector/pdata/ptrace/pb.go b/vendor/go.opentelemetry.io/collector/pdata/ptrace/pb.go index e0b2168884a..a3c78be27c1 100644 --- a/vendor/go.opentelemetry.io/collector/pdata/ptrace/pb.go +++ b/vendor/go.opentelemetry.io/collector/pdata/ptrace/pb.go @@ -22,6 +22,18 @@ func (e *ProtoMarshaler) TracesSize(td Traces) int { return pb.Size() } +func (e *ProtoMarshaler) ResourceSpansSize(rs ResourceSpans) int { + return rs.orig.Size() +} + +func (e *ProtoMarshaler) ScopeSpansSize(ss ScopeSpans) int { + return ss.orig.Size() +} + +func (e *ProtoMarshaler) SpanSize(span Span) int { + return span.orig.Size() +} + type ProtoUnmarshaler struct{} func (d *ProtoUnmarshaler) UnmarshalTraces(buf []byte) (Traces, error) { diff --git a/vendor/go.opentelemetry.io/otel/exporters/otlp/otlptrace/version.go b/vendor/go.opentelemetry.io/otel/exporters/otlp/otlptrace/version.go index f156ee66720..f5cad46b74d 100644 --- a/vendor/go.opentelemetry.io/otel/exporters/otlp/otlptrace/version.go +++ b/vendor/go.opentelemetry.io/otel/exporters/otlp/otlptrace/version.go @@ -5,5 +5,5 @@ package otlptrace // import "go.opentelemetry.io/otel/exporters/otlp/otlptrace" // Version is the current release version of the OpenTelemetry OTLP trace exporter in use. func Version() string { - return "1.34.0" + return "1.35.0" } diff --git a/vendor/golang.org/x/crypto/cryptobyte/asn1.go b/vendor/golang.org/x/crypto/cryptobyte/asn1.go index 2492f796af9..d25979d9f53 100644 --- a/vendor/golang.org/x/crypto/cryptobyte/asn1.go +++ b/vendor/golang.org/x/crypto/cryptobyte/asn1.go @@ -234,7 +234,7 @@ func (b *Builder) AddASN1(tag asn1.Tag, f BuilderContinuation) { // Identifiers with the low five bits set indicate high-tag-number format // (two or more octets), which we don't support. if tag&0x1f == 0x1f { - b.err = fmt.Errorf("cryptobyte: high-tag number identifier octects not supported: 0x%x", tag) + b.err = fmt.Errorf("cryptobyte: high-tag number identifier octets not supported: 0x%x", tag) return } b.AddUint8(uint8(tag)) diff --git a/vendor/golang.org/x/crypto/internal/poly1305/mac_noasm.go b/vendor/golang.org/x/crypto/internal/poly1305/mac_noasm.go index bd896bdc76d..8d99551feec 100644 --- a/vendor/golang.org/x/crypto/internal/poly1305/mac_noasm.go +++ b/vendor/golang.org/x/crypto/internal/poly1305/mac_noasm.go @@ -2,7 +2,7 @@ // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. -//go:build (!amd64 && !ppc64le && !ppc64 && !s390x) || !gc || purego +//go:build (!amd64 && !loong64 && !ppc64le && !ppc64 && !s390x) || !gc || purego package poly1305 diff --git a/vendor/golang.org/x/crypto/internal/poly1305/sum_amd64.go b/vendor/golang.org/x/crypto/internal/poly1305/sum_asm.go similarity index 94% rename from vendor/golang.org/x/crypto/internal/poly1305/sum_amd64.go rename to vendor/golang.org/x/crypto/internal/poly1305/sum_asm.go index 164cd47d322..315b84ac39b 100644 --- a/vendor/golang.org/x/crypto/internal/poly1305/sum_amd64.go +++ b/vendor/golang.org/x/crypto/internal/poly1305/sum_asm.go @@ -2,7 +2,7 @@ // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. -//go:build gc && !purego +//go:build gc && !purego && (amd64 || loong64 || ppc64 || ppc64le) package poly1305 diff --git a/vendor/golang.org/x/crypto/internal/poly1305/sum_loong64.s b/vendor/golang.org/x/crypto/internal/poly1305/sum_loong64.s new file mode 100644 index 00000000000..bc8361da402 --- /dev/null +++ b/vendor/golang.org/x/crypto/internal/poly1305/sum_loong64.s @@ -0,0 +1,123 @@ +// Copyright 2025 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build gc && !purego + +// func update(state *macState, msg []byte) +TEXT ·update(SB), $0-32 + MOVV state+0(FP), R4 + MOVV msg_base+8(FP), R5 + MOVV msg_len+16(FP), R6 + + MOVV $0x10, R7 + + MOVV (R4), R8 // h0 + MOVV 8(R4), R9 // h1 + MOVV 16(R4), R10 // h2 + MOVV 24(R4), R11 // r0 + MOVV 32(R4), R12 // r1 + + BLT R6, R7, bytes_between_0_and_15 + +loop: + MOVV (R5), R14 // msg[0:8] + MOVV 8(R5), R16 // msg[8:16] + ADDV R14, R8, R8 // h0 (x1 + y1 = z1', if z1' < x1 then z1' overflow) + ADDV R16, R9, R27 + SGTU R14, R8, R24 // h0.carry + SGTU R9, R27, R28 + ADDV R27, R24, R9 // h1 + SGTU R27, R9, R24 + OR R24, R28, R24 // h1.carry + ADDV $0x01, R24, R24 + ADDV R10, R24, R10 // h2 + + ADDV $16, R5, R5 // msg = msg[16:] + +multiply: + MULV R8, R11, R14 // h0r0.lo + MULHVU R8, R11, R15 // h0r0.hi + MULV R9, R11, R13 // h1r0.lo + MULHVU R9, R11, R16 // h1r0.hi + ADDV R13, R15, R15 + SGTU R13, R15, R24 + ADDV R24, R16, R16 + MULV R10, R11, R25 + ADDV R16, R25, R25 + MULV R8, R12, R13 // h0r1.lo + MULHVU R8, R12, R16 // h0r1.hi + ADDV R13, R15, R15 + SGTU R13, R15, R24 + ADDV R24, R16, R16 + MOVV R16, R8 + MULV R10, R12, R26 // h2r1 + MULV R9, R12, R13 // h1r1.lo + MULHVU R9, R12, R16 // h1r1.hi + ADDV R13, R25, R25 + ADDV R16, R26, R27 + SGTU R13, R25, R24 + ADDV R27, R24, R26 + ADDV R8, R25, R25 + SGTU R8, R25, R24 + ADDV R24, R26, R26 + AND $3, R25, R10 + AND $-4, R25, R17 + ADDV R17, R14, R8 + ADDV R26, R15, R27 + SGTU R17, R8, R24 + SGTU R26, R27, R28 + ADDV R27, R24, R9 + SGTU R27, R9, R24 + OR R24, R28, R24 + ADDV R24, R10, R10 + SLLV $62, R26, R27 + SRLV $2, R25, R28 + SRLV $2, R26, R26 + OR R27, R28, R25 + ADDV R25, R8, R8 + ADDV R26, R9, R27 + SGTU R25, R8, R24 + SGTU R26, R27, R28 + ADDV R27, R24, R9 + SGTU R27, R9, R24 + OR R24, R28, R24 + ADDV R24, R10, R10 + + SUBV $16, R6, R6 + BGE R6, R7, loop + +bytes_between_0_and_15: + BEQ R6, R0, done + MOVV $1, R14 + XOR R15, R15 + ADDV R6, R5, R5 + +flush_buffer: + MOVBU -1(R5), R25 + SRLV $56, R14, R24 + SLLV $8, R15, R28 + SLLV $8, R14, R14 + OR R24, R28, R15 + XOR R25, R14, R14 + SUBV $1, R6, R6 + SUBV $1, R5, R5 + BNE R6, R0, flush_buffer + + ADDV R14, R8, R8 + SGTU R14, R8, R24 + ADDV R15, R9, R27 + SGTU R15, R27, R28 + ADDV R27, R24, R9 + SGTU R27, R9, R24 + OR R24, R28, R24 + ADDV R10, R24, R10 + + MOVV $16, R6 + JMP multiply + +done: + MOVV R8, (R4) + MOVV R9, 8(R4) + MOVV R10, 16(R4) + RET diff --git a/vendor/golang.org/x/crypto/internal/poly1305/sum_ppc64x.go b/vendor/golang.org/x/crypto/internal/poly1305/sum_ppc64x.go deleted file mode 100644 index 1a1679aaad9..00000000000 --- a/vendor/golang.org/x/crypto/internal/poly1305/sum_ppc64x.go +++ /dev/null @@ -1,47 +0,0 @@ -// Copyright 2019 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -//go:build gc && !purego && (ppc64 || ppc64le) - -package poly1305 - -//go:noescape -func update(state *macState, msg []byte) - -// mac is a wrapper for macGeneric that redirects calls that would have gone to -// updateGeneric to update. -// -// Its Write and Sum methods are otherwise identical to the macGeneric ones, but -// using function pointers would carry a major performance cost. -type mac struct{ macGeneric } - -func (h *mac) Write(p []byte) (int, error) { - nn := len(p) - if h.offset > 0 { - n := copy(h.buffer[h.offset:], p) - if h.offset+n < TagSize { - h.offset += n - return nn, nil - } - p = p[n:] - h.offset = 0 - update(&h.macState, h.buffer[:]) - } - if n := len(p) - (len(p) % TagSize); n > 0 { - update(&h.macState, p[:n]) - p = p[n:] - } - if len(p) > 0 { - h.offset += copy(h.buffer[h.offset:], p) - } - return nn, nil -} - -func (h *mac) Sum(out *[16]byte) { - state := h.macState - if h.offset > 0 { - update(&state, h.buffer[:h.offset]) - } - finalize(out, &state.h, &state.s) -} diff --git a/vendor/golang.org/x/exp/LICENSE b/vendor/golang.org/x/exp/LICENSE index 6a66aea5eaf..2a7cf70da6e 100644 --- a/vendor/golang.org/x/exp/LICENSE +++ b/vendor/golang.org/x/exp/LICENSE @@ -1,4 +1,4 @@ -Copyright (c) 2009 The Go Authors. All rights reserved. +Copyright 2009 The Go Authors. Redistribution and use in source and binary forms, with or without modification, are permitted provided that the following conditions are @@ -10,7 +10,7 @@ notice, this list of conditions and the following disclaimer. copyright notice, this list of conditions and the following disclaimer in the documentation and/or other materials provided with the distribution. - * Neither the name of Google Inc. nor the names of its + * Neither the name of Google LLC nor the names of its contributors may be used to endorse or promote products derived from this software without specific prior written permission. diff --git a/vendor/golang.org/x/exp/constraints/constraints.go b/vendor/golang.org/x/exp/constraints/constraints.go index 2c033dff47e..a9392af7c1a 100644 --- a/vendor/golang.org/x/exp/constraints/constraints.go +++ b/vendor/golang.org/x/exp/constraints/constraints.go @@ -45,6 +45,8 @@ type Complex interface { // that supports the operators < <= >= >. // If future releases of Go add new ordered types, // this constraint will be modified to include them. +// +// This type is redundant since Go 1.21 introduced [cmp.Ordered]. type Ordered interface { Integer | Float | ~string } diff --git a/vendor/golang.org/x/exp/slices/cmp.go b/vendor/golang.org/x/exp/slices/cmp.go deleted file mode 100644 index fbf1934a061..00000000000 --- a/vendor/golang.org/x/exp/slices/cmp.go +++ /dev/null @@ -1,44 +0,0 @@ -// Copyright 2023 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package slices - -import "golang.org/x/exp/constraints" - -// min is a version of the predeclared function from the Go 1.21 release. -func min[T constraints.Ordered](a, b T) T { - if a < b || isNaN(a) { - return a - } - return b -} - -// max is a version of the predeclared function from the Go 1.21 release. -func max[T constraints.Ordered](a, b T) T { - if a > b || isNaN(a) { - return a - } - return b -} - -// cmpLess is a copy of cmp.Less from the Go 1.21 release. -func cmpLess[T constraints.Ordered](x, y T) bool { - return (isNaN(x) && !isNaN(y)) || x < y -} - -// cmpCompare is a copy of cmp.Compare from the Go 1.21 release. -func cmpCompare[T constraints.Ordered](x, y T) int { - xNaN := isNaN(x) - yNaN := isNaN(y) - if xNaN && yNaN { - return 0 - } - if xNaN || x < y { - return -1 - } - if yNaN || x > y { - return +1 - } - return 0 -} diff --git a/vendor/golang.org/x/exp/slices/slices.go b/vendor/golang.org/x/exp/slices/slices.go index 46ceac34399..757383ea1c0 100644 --- a/vendor/golang.org/x/exp/slices/slices.go +++ b/vendor/golang.org/x/exp/slices/slices.go @@ -6,26 +6,22 @@ package slices import ( - "unsafe" - - "golang.org/x/exp/constraints" + "cmp" + "slices" ) +// TODO(adonovan): when https://go.dev/issue/32816 is accepted, all of +// these functions should be annotated (provisionally with "//go:fix +// inline") so that tools can safely and automatically replace calls +// to exp/slices with calls to std slices by inlining them. + // Equal reports whether two slices are equal: the same length and all // elements equal. If the lengths are different, Equal returns false. // Otherwise, the elements are compared in increasing index order, and the // comparison stops at the first unequal pair. // Floating point NaNs are not considered equal. func Equal[S ~[]E, E comparable](s1, s2 S) bool { - if len(s1) != len(s2) { - return false - } - for i := range s1 { - if s1[i] != s2[i] { - return false - } - } - return true + return slices.Equal(s1, s2) } // EqualFunc reports whether two slices are equal using an equality @@ -34,16 +30,7 @@ func Equal[S ~[]E, E comparable](s1, s2 S) bool { // increasing index order, and the comparison stops at the first index // for which eq returns false. func EqualFunc[S1 ~[]E1, S2 ~[]E2, E1, E2 any](s1 S1, s2 S2, eq func(E1, E2) bool) bool { - if len(s1) != len(s2) { - return false - } - for i, v1 := range s1 { - v2 := s2[i] - if !eq(v1, v2) { - return false - } - } - return true + return slices.EqualFunc(s1, s2, eq) } // Compare compares the elements of s1 and s2, using [cmp.Compare] on each pair @@ -53,20 +40,8 @@ func EqualFunc[S1 ~[]E1, S2 ~[]E2, E1, E2 any](s1 S1, s2 S2, eq func(E1, E2) boo // If both slices are equal until one of them ends, the shorter slice is // considered less than the longer one. // The result is 0 if s1 == s2, -1 if s1 < s2, and +1 if s1 > s2. -func Compare[S ~[]E, E constraints.Ordered](s1, s2 S) int { - for i, v1 := range s1 { - if i >= len(s2) { - return +1 - } - v2 := s2[i] - if c := cmpCompare(v1, v2); c != 0 { - return c - } - } - if len(s1) < len(s2) { - return -1 - } - return 0 +func Compare[S ~[]E, E cmp.Ordered](s1, s2 S) int { + return slices.Compare(s1, s2) } // CompareFunc is like [Compare] but uses a custom comparison function on each @@ -75,52 +50,30 @@ func Compare[S ~[]E, E constraints.Ordered](s1, s2 S) int { // returns 0 the result is 0 if len(s1) == len(s2), -1 if len(s1) < len(s2), // and +1 if len(s1) > len(s2). func CompareFunc[S1 ~[]E1, S2 ~[]E2, E1, E2 any](s1 S1, s2 S2, cmp func(E1, E2) int) int { - for i, v1 := range s1 { - if i >= len(s2) { - return +1 - } - v2 := s2[i] - if c := cmp(v1, v2); c != 0 { - return c - } - } - if len(s1) < len(s2) { - return -1 - } - return 0 + return slices.CompareFunc(s1, s2, cmp) } // Index returns the index of the first occurrence of v in s, // or -1 if not present. func Index[S ~[]E, E comparable](s S, v E) int { - for i := range s { - if v == s[i] { - return i - } - } - return -1 + return slices.Index(s, v) } // IndexFunc returns the first index i satisfying f(s[i]), // or -1 if none do. func IndexFunc[S ~[]E, E any](s S, f func(E) bool) int { - for i := range s { - if f(s[i]) { - return i - } - } - return -1 + return slices.IndexFunc(s, f) } // Contains reports whether v is present in s. func Contains[S ~[]E, E comparable](s S, v E) bool { - return Index(s, v) >= 0 + return slices.Contains(s, v) } // ContainsFunc reports whether at least one // element e of s satisfies f(e). func ContainsFunc[S ~[]E, E any](s S, f func(E) bool) bool { - return IndexFunc(s, f) >= 0 + return slices.ContainsFunc(s, f) } // Insert inserts the values v... into s at index i, @@ -131,92 +84,7 @@ func ContainsFunc[S ~[]E, E any](s S, f func(E) bool) bool { // Insert panics if i is out of range. // This function is O(len(s) + len(v)). func Insert[S ~[]E, E any](s S, i int, v ...E) S { - m := len(v) - if m == 0 { - return s - } - n := len(s) - if i == n { - return append(s, v...) - } - if n+m > cap(s) { - // Use append rather than make so that we bump the size of - // the slice up to the next storage class. - // This is what Grow does but we don't call Grow because - // that might copy the values twice. - s2 := append(s[:i], make(S, n+m-i)...) - copy(s2[i:], v) - copy(s2[i+m:], s[i:]) - return s2 - } - s = s[:n+m] - - // before: - // s: aaaaaaaabbbbccccccccdddd - // ^ ^ ^ ^ - // i i+m n n+m - // after: - // s: aaaaaaaavvvvbbbbcccccccc - // ^ ^ ^ ^ - // i i+m n n+m - // - // a are the values that don't move in s. - // v are the values copied in from v. - // b and c are the values from s that are shifted up in index. - // d are the values that get overwritten, never to be seen again. - - if !overlaps(v, s[i+m:]) { - // Easy case - v does not overlap either the c or d regions. - // (It might be in some of a or b, or elsewhere entirely.) - // The data we copy up doesn't write to v at all, so just do it. - - copy(s[i+m:], s[i:]) - - // Now we have - // s: aaaaaaaabbbbbbbbcccccccc - // ^ ^ ^ ^ - // i i+m n n+m - // Note the b values are duplicated. - - copy(s[i:], v) - - // Now we have - // s: aaaaaaaavvvvbbbbcccccccc - // ^ ^ ^ ^ - // i i+m n n+m - // That's the result we want. - return s - } - - // The hard case - v overlaps c or d. We can't just shift up - // the data because we'd move or clobber the values we're trying - // to insert. - // So instead, write v on top of d, then rotate. - copy(s[n:], v) - - // Now we have - // s: aaaaaaaabbbbccccccccvvvv - // ^ ^ ^ ^ - // i i+m n n+m - - rotateRight(s[i:], m) - - // Now we have - // s: aaaaaaaavvvvbbbbcccccccc - // ^ ^ ^ ^ - // i i+m n n+m - // That's the result we want. - return s -} - -// clearSlice sets all elements up to the length of s to the zero value of E. -// We may use the builtin clear func instead, and remove clearSlice, when upgrading -// to Go 1.21+. -func clearSlice[S ~[]E, E any](s S) { - var zero E - for i := range s { - s[i] = zero - } + return slices.Insert(s, i, v...) } // Delete removes the elements s[i:j] from s, returning the modified slice. @@ -225,135 +93,27 @@ func clearSlice[S ~[]E, E any](s S) { // make a single call deleting them all together than to delete one at a time. // Delete zeroes the elements s[len(s)-(j-i):len(s)]. func Delete[S ~[]E, E any](s S, i, j int) S { - _ = s[i:j:len(s)] // bounds check - - if i == j { - return s - } - - oldlen := len(s) - s = append(s[:i], s[j:]...) - clearSlice(s[len(s):oldlen]) // zero/nil out the obsolete elements, for GC - return s + return slices.Delete(s, i, j) } // DeleteFunc removes any elements from s for which del returns true, // returning the modified slice. // DeleteFunc zeroes the elements between the new length and the original length. func DeleteFunc[S ~[]E, E any](s S, del func(E) bool) S { - i := IndexFunc(s, del) - if i == -1 { - return s - } - // Don't start copying elements until we find one to delete. - for j := i + 1; j < len(s); j++ { - if v := s[j]; !del(v) { - s[i] = v - i++ - } - } - clearSlice(s[i:]) // zero/nil out the obsolete elements, for GC - return s[:i] + return slices.DeleteFunc(s, del) } // Replace replaces the elements s[i:j] by the given v, and returns the // modified slice. Replace panics if s[i:j] is not a valid slice of s. // When len(v) < (j-i), Replace zeroes the elements between the new length and the original length. func Replace[S ~[]E, E any](s S, i, j int, v ...E) S { - _ = s[i:j] // verify that i:j is a valid subslice - - if i == j { - return Insert(s, i, v...) - } - if j == len(s) { - return append(s[:i], v...) - } - - tot := len(s[:i]) + len(v) + len(s[j:]) - if tot > cap(s) { - // Too big to fit, allocate and copy over. - s2 := append(s[:i], make(S, tot-i)...) // See Insert - copy(s2[i:], v) - copy(s2[i+len(v):], s[j:]) - return s2 - } - - r := s[:tot] - - if i+len(v) <= j { - // Easy, as v fits in the deleted portion. - copy(r[i:], v) - if i+len(v) != j { - copy(r[i+len(v):], s[j:]) - } - clearSlice(s[tot:]) // zero/nil out the obsolete elements, for GC - return r - } - - // We are expanding (v is bigger than j-i). - // The situation is something like this: - // (example has i=4,j=8,len(s)=16,len(v)=6) - // s: aaaaxxxxbbbbbbbbyy - // ^ ^ ^ ^ - // i j len(s) tot - // a: prefix of s - // x: deleted range - // b: more of s - // y: area to expand into - - if !overlaps(r[i+len(v):], v) { - // Easy, as v is not clobbered by the first copy. - copy(r[i+len(v):], s[j:]) - copy(r[i:], v) - return r - } - - // This is a situation where we don't have a single place to which - // we can copy v. Parts of it need to go to two different places. - // We want to copy the prefix of v into y and the suffix into x, then - // rotate |y| spots to the right. - // - // v[2:] v[:2] - // | | - // s: aaaavvvvbbbbbbbbvv - // ^ ^ ^ ^ - // i j len(s) tot - // - // If either of those two destinations don't alias v, then we're good. - y := len(v) - (j - i) // length of y portion - - if !overlaps(r[i:j], v) { - copy(r[i:j], v[y:]) - copy(r[len(s):], v[:y]) - rotateRight(r[i:], y) - return r - } - if !overlaps(r[len(s):], v) { - copy(r[len(s):], v[:y]) - copy(r[i:j], v[y:]) - rotateRight(r[i:], y) - return r - } - - // Now we know that v overlaps both x and y. - // That means that the entirety of b is *inside* v. - // So we don't need to preserve b at all; instead we - // can copy v first, then copy the b part of v out of - // v to the right destination. - k := startIdx(v, s[j:]) - copy(r[i:], v) - copy(r[i+len(v):], r[i+k:]) - return r + return slices.Replace(s, i, j, v...) } // Clone returns a copy of the slice. // The elements are copied using assignment, so this is a shallow clone. func Clone[S ~[]E, E any](s S) S { - // Preserve nil in case it matters. - if s == nil { - return nil - } - return append(S([]E{}), s...) + return slices.Clone(s) } // Compact replaces consecutive runs of equal elements with a single copy. @@ -362,40 +122,14 @@ func Clone[S ~[]E, E any](s S) S { // which may have a smaller length. // Compact zeroes the elements between the new length and the original length. func Compact[S ~[]E, E comparable](s S) S { - if len(s) < 2 { - return s - } - i := 1 - for k := 1; k < len(s); k++ { - if s[k] != s[k-1] { - if i != k { - s[i] = s[k] - } - i++ - } - } - clearSlice(s[i:]) // zero/nil out the obsolete elements, for GC - return s[:i] + return slices.Compact(s) } // CompactFunc is like [Compact] but uses an equality function to compare elements. // For runs of elements that compare equal, CompactFunc keeps the first one. // CompactFunc zeroes the elements between the new length and the original length. func CompactFunc[S ~[]E, E any](s S, eq func(E, E) bool) S { - if len(s) < 2 { - return s - } - i := 1 - for k := 1; k < len(s); k++ { - if !eq(s[k], s[k-1]) { - if i != k { - s[i] = s[k] - } - i++ - } - } - clearSlice(s[i:]) // zero/nil out the obsolete elements, for GC - return s[:i] + return slices.CompactFunc(s, eq) } // Grow increases the slice's capacity, if necessary, to guarantee space for @@ -403,113 +137,15 @@ func CompactFunc[S ~[]E, E any](s S, eq func(E, E) bool) S { // to the slice without another allocation. If n is negative or too large to // allocate the memory, Grow panics. func Grow[S ~[]E, E any](s S, n int) S { - if n < 0 { - panic("cannot be negative") - } - if n -= cap(s) - len(s); n > 0 { - // TODO(https://go.dev/issue/53888): Make using []E instead of S - // to workaround a compiler bug where the runtime.growslice optimization - // does not take effect. Revert when the compiler is fixed. - s = append([]E(s)[:cap(s)], make([]E, n)...)[:len(s)] - } - return s + return slices.Grow(s, n) } // Clip removes unused capacity from the slice, returning s[:len(s):len(s)]. func Clip[S ~[]E, E any](s S) S { - return s[:len(s):len(s)] -} - -// Rotation algorithm explanation: -// -// rotate left by 2 -// start with -// 0123456789 -// split up like this -// 01 234567 89 -// swap first 2 and last 2 -// 89 234567 01 -// join first parts -// 89234567 01 -// recursively rotate first left part by 2 -// 23456789 01 -// join at the end -// 2345678901 -// -// rotate left by 8 -// start with -// 0123456789 -// split up like this -// 01 234567 89 -// swap first 2 and last 2 -// 89 234567 01 -// join last parts -// 89 23456701 -// recursively rotate second part left by 6 -// 89 01234567 -// join at the end -// 8901234567 - -// TODO: There are other rotate algorithms. -// This algorithm has the desirable property that it moves each element exactly twice. -// The triple-reverse algorithm is simpler and more cache friendly, but takes more writes. -// The follow-cycles algorithm can be 1-write but it is not very cache friendly. - -// rotateLeft rotates b left by n spaces. -// s_final[i] = s_orig[i+r], wrapping around. -func rotateLeft[E any](s []E, r int) { - for r != 0 && r != len(s) { - if r*2 <= len(s) { - swap(s[:r], s[len(s)-r:]) - s = s[:len(s)-r] - } else { - swap(s[:len(s)-r], s[r:]) - s, r = s[len(s)-r:], r*2-len(s) - } - } -} -func rotateRight[E any](s []E, r int) { - rotateLeft(s, len(s)-r) -} - -// swap swaps the contents of x and y. x and y must be equal length and disjoint. -func swap[E any](x, y []E) { - for i := 0; i < len(x); i++ { - x[i], y[i] = y[i], x[i] - } -} - -// overlaps reports whether the memory ranges a[0:len(a)] and b[0:len(b)] overlap. -func overlaps[E any](a, b []E) bool { - if len(a) == 0 || len(b) == 0 { - return false - } - elemSize := unsafe.Sizeof(a[0]) - if elemSize == 0 { - return false - } - // TODO: use a runtime/unsafe facility once one becomes available. See issue 12445. - // Also see crypto/internal/alias/alias.go:AnyOverlap - return uintptr(unsafe.Pointer(&a[0])) <= uintptr(unsafe.Pointer(&b[len(b)-1]))+(elemSize-1) && - uintptr(unsafe.Pointer(&b[0])) <= uintptr(unsafe.Pointer(&a[len(a)-1]))+(elemSize-1) -} - -// startIdx returns the index in haystack where the needle starts. -// prerequisite: the needle must be aliased entirely inside the haystack. -func startIdx[E any](haystack, needle []E) int { - p := &needle[0] - for i := range haystack { - if p == &haystack[i] { - return i - } - } - // TODO: what if the overlap is by a non-integral number of Es? - panic("needle not found") + return slices.Clip(s) } // Reverse reverses the elements of the slice in place. func Reverse[S ~[]E, E any](s S) { - for i, j := 0, len(s)-1; i < j; i, j = i+1, j-1 { - s[i], s[j] = s[j], s[i] - } + slices.Reverse(s) } diff --git a/vendor/golang.org/x/exp/slices/sort.go b/vendor/golang.org/x/exp/slices/sort.go index f58bbc7ba4d..e270a74652f 100644 --- a/vendor/golang.org/x/exp/slices/sort.go +++ b/vendor/golang.org/x/exp/slices/sort.go @@ -2,21 +2,20 @@ // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. -//go:generate go run $GOROOT/src/sort/gen_sort_variants.go -exp - package slices import ( - "math/bits" - - "golang.org/x/exp/constraints" + "cmp" + "slices" ) +// TODO(adonovan): add a "//go:fix inline" annotation to each function +// in this file; see https://go.dev/issue/32816. + // Sort sorts a slice of any ordered type in ascending order. // When sorting floating-point numbers, NaNs are ordered before other values. -func Sort[S ~[]E, E constraints.Ordered](x S) { - n := len(x) - pdqsortOrdered(x, 0, n, bits.Len(uint(n))) +func Sort[S ~[]E, E cmp.Ordered](x S) { + slices.Sort(x) } // SortFunc sorts the slice x in ascending order as determined by the cmp @@ -29,118 +28,60 @@ func Sort[S ~[]E, E constraints.Ordered](x S) { // See https://en.wikipedia.org/wiki/Weak_ordering#Strict_weak_orderings. // To indicate 'uncomparable', return 0 from the function. func SortFunc[S ~[]E, E any](x S, cmp func(a, b E) int) { - n := len(x) - pdqsortCmpFunc(x, 0, n, bits.Len(uint(n)), cmp) + slices.SortFunc(x, cmp) } // SortStableFunc sorts the slice x while keeping the original order of equal // elements, using cmp to compare elements in the same way as [SortFunc]. func SortStableFunc[S ~[]E, E any](x S, cmp func(a, b E) int) { - stableCmpFunc(x, len(x), cmp) + slices.SortStableFunc(x, cmp) } // IsSorted reports whether x is sorted in ascending order. -func IsSorted[S ~[]E, E constraints.Ordered](x S) bool { - for i := len(x) - 1; i > 0; i-- { - if cmpLess(x[i], x[i-1]) { - return false - } - } - return true +func IsSorted[S ~[]E, E cmp.Ordered](x S) bool { + return slices.IsSorted(x) } // IsSortedFunc reports whether x is sorted in ascending order, with cmp as the // comparison function as defined by [SortFunc]. func IsSortedFunc[S ~[]E, E any](x S, cmp func(a, b E) int) bool { - for i := len(x) - 1; i > 0; i-- { - if cmp(x[i], x[i-1]) < 0 { - return false - } - } - return true + return slices.IsSortedFunc(x, cmp) } // Min returns the minimal value in x. It panics if x is empty. // For floating-point numbers, Min propagates NaNs (any NaN value in x // forces the output to be NaN). -func Min[S ~[]E, E constraints.Ordered](x S) E { - if len(x) < 1 { - panic("slices.Min: empty list") - } - m := x[0] - for i := 1; i < len(x); i++ { - m = min(m, x[i]) - } - return m +func Min[S ~[]E, E cmp.Ordered](x S) E { + return slices.Min(x) } // MinFunc returns the minimal value in x, using cmp to compare elements. // It panics if x is empty. If there is more than one minimal element // according to the cmp function, MinFunc returns the first one. func MinFunc[S ~[]E, E any](x S, cmp func(a, b E) int) E { - if len(x) < 1 { - panic("slices.MinFunc: empty list") - } - m := x[0] - for i := 1; i < len(x); i++ { - if cmp(x[i], m) < 0 { - m = x[i] - } - } - return m + return slices.MinFunc(x, cmp) } // Max returns the maximal value in x. It panics if x is empty. // For floating-point E, Max propagates NaNs (any NaN value in x // forces the output to be NaN). -func Max[S ~[]E, E constraints.Ordered](x S) E { - if len(x) < 1 { - panic("slices.Max: empty list") - } - m := x[0] - for i := 1; i < len(x); i++ { - m = max(m, x[i]) - } - return m +func Max[S ~[]E, E cmp.Ordered](x S) E { + return slices.Max(x) } // MaxFunc returns the maximal value in x, using cmp to compare elements. // It panics if x is empty. If there is more than one maximal element // according to the cmp function, MaxFunc returns the first one. func MaxFunc[S ~[]E, E any](x S, cmp func(a, b E) int) E { - if len(x) < 1 { - panic("slices.MaxFunc: empty list") - } - m := x[0] - for i := 1; i < len(x); i++ { - if cmp(x[i], m) > 0 { - m = x[i] - } - } - return m + return slices.MaxFunc(x, cmp) } // BinarySearch searches for target in a sorted slice and returns the position // where target is found, or the position where target would appear in the // sort order; it also returns a bool saying whether the target is really found // in the slice. The slice must be sorted in increasing order. -func BinarySearch[S ~[]E, E constraints.Ordered](x S, target E) (int, bool) { - // Inlining is faster than calling BinarySearchFunc with a lambda. - n := len(x) - // Define x[-1] < target and x[n] >= target. - // Invariant: x[i-1] < target, x[j] >= target. - i, j := 0, n - for i < j { - h := int(uint(i+j) >> 1) // avoid overflow when computing h - // i ≤ h < j - if cmpLess(x[h], target) { - i = h + 1 // preserves x[i-1] < target - } else { - j = h // preserves x[j] >= target - } - } - // i == j, x[i-1] < target, and x[j] (= x[i]) >= target => answer is i. - return i, i < n && (x[i] == target || (isNaN(x[i]) && isNaN(target))) +func BinarySearch[S ~[]E, E cmp.Ordered](x S, target E) (int, bool) { + return slices.BinarySearch(x, target) } // BinarySearchFunc works like [BinarySearch], but uses a custom comparison @@ -151,47 +92,5 @@ func BinarySearch[S ~[]E, E constraints.Ordered](x S, target E) (int, bool) { // cmp must implement the same ordering as the slice, such that if // cmp(a, t) < 0 and cmp(b, t) >= 0, then a must precede b in the slice. func BinarySearchFunc[S ~[]E, E, T any](x S, target T, cmp func(E, T) int) (int, bool) { - n := len(x) - // Define cmp(x[-1], target) < 0 and cmp(x[n], target) >= 0 . - // Invariant: cmp(x[i - 1], target) < 0, cmp(x[j], target) >= 0. - i, j := 0, n - for i < j { - h := int(uint(i+j) >> 1) // avoid overflow when computing h - // i ≤ h < j - if cmp(x[h], target) < 0 { - i = h + 1 // preserves cmp(x[i - 1], target) < 0 - } else { - j = h // preserves cmp(x[j], target) >= 0 - } - } - // i == j, cmp(x[i-1], target) < 0, and cmp(x[j], target) (= cmp(x[i], target)) >= 0 => answer is i. - return i, i < n && cmp(x[i], target) == 0 -} - -type sortedHint int // hint for pdqsort when choosing the pivot - -const ( - unknownHint sortedHint = iota - increasingHint - decreasingHint -) - -// xorshift paper: https://www.jstatsoft.org/article/view/v008i14/xorshift.pdf -type xorshift uint64 - -func (r *xorshift) Next() uint64 { - *r ^= *r << 13 - *r ^= *r >> 17 - *r ^= *r << 5 - return uint64(*r) -} - -func nextPowerOfTwo(length int) uint { - return 1 << bits.Len(uint(length)) -} - -// isNaN reports whether x is a NaN without requiring the math package. -// This will always return false if T is not floating-point. -func isNaN[T constraints.Ordered](x T) bool { - return x != x + return slices.BinarySearchFunc(x, target, cmp) } diff --git a/vendor/golang.org/x/exp/slices/zsortanyfunc.go b/vendor/golang.org/x/exp/slices/zsortanyfunc.go deleted file mode 100644 index 06f2c7a2481..00000000000 --- a/vendor/golang.org/x/exp/slices/zsortanyfunc.go +++ /dev/null @@ -1,479 +0,0 @@ -// Code generated by gen_sort_variants.go; DO NOT EDIT. - -// Copyright 2022 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package slices - -// insertionSortCmpFunc sorts data[a:b] using insertion sort. -func insertionSortCmpFunc[E any](data []E, a, b int, cmp func(a, b E) int) { - for i := a + 1; i < b; i++ { - for j := i; j > a && (cmp(data[j], data[j-1]) < 0); j-- { - data[j], data[j-1] = data[j-1], data[j] - } - } -} - -// siftDownCmpFunc implements the heap property on data[lo:hi]. -// first is an offset into the array where the root of the heap lies. -func siftDownCmpFunc[E any](data []E, lo, hi, first int, cmp func(a, b E) int) { - root := lo - for { - child := 2*root + 1 - if child >= hi { - break - } - if child+1 < hi && (cmp(data[first+child], data[first+child+1]) < 0) { - child++ - } - if !(cmp(data[first+root], data[first+child]) < 0) { - return - } - data[first+root], data[first+child] = data[first+child], data[first+root] - root = child - } -} - -func heapSortCmpFunc[E any](data []E, a, b int, cmp func(a, b E) int) { - first := a - lo := 0 - hi := b - a - - // Build heap with greatest element at top. - for i := (hi - 1) / 2; i >= 0; i-- { - siftDownCmpFunc(data, i, hi, first, cmp) - } - - // Pop elements, largest first, into end of data. - for i := hi - 1; i >= 0; i-- { - data[first], data[first+i] = data[first+i], data[first] - siftDownCmpFunc(data, lo, i, first, cmp) - } -} - -// pdqsortCmpFunc sorts data[a:b]. -// The algorithm based on pattern-defeating quicksort(pdqsort), but without the optimizations from BlockQuicksort. -// pdqsort paper: https://arxiv.org/pdf/2106.05123.pdf -// C++ implementation: https://github.com/orlp/pdqsort -// Rust implementation: https://docs.rs/pdqsort/latest/pdqsort/ -// limit is the number of allowed bad (very unbalanced) pivots before falling back to heapsort. -func pdqsortCmpFunc[E any](data []E, a, b, limit int, cmp func(a, b E) int) { - const maxInsertion = 12 - - var ( - wasBalanced = true // whether the last partitioning was reasonably balanced - wasPartitioned = true // whether the slice was already partitioned - ) - - for { - length := b - a - - if length <= maxInsertion { - insertionSortCmpFunc(data, a, b, cmp) - return - } - - // Fall back to heapsort if too many bad choices were made. - if limit == 0 { - heapSortCmpFunc(data, a, b, cmp) - return - } - - // If the last partitioning was imbalanced, we need to breaking patterns. - if !wasBalanced { - breakPatternsCmpFunc(data, a, b, cmp) - limit-- - } - - pivot, hint := choosePivotCmpFunc(data, a, b, cmp) - if hint == decreasingHint { - reverseRangeCmpFunc(data, a, b, cmp) - // The chosen pivot was pivot-a elements after the start of the array. - // After reversing it is pivot-a elements before the end of the array. - // The idea came from Rust's implementation. - pivot = (b - 1) - (pivot - a) - hint = increasingHint - } - - // The slice is likely already sorted. - if wasBalanced && wasPartitioned && hint == increasingHint { - if partialInsertionSortCmpFunc(data, a, b, cmp) { - return - } - } - - // Probably the slice contains many duplicate elements, partition the slice into - // elements equal to and elements greater than the pivot. - if a > 0 && !(cmp(data[a-1], data[pivot]) < 0) { - mid := partitionEqualCmpFunc(data, a, b, pivot, cmp) - a = mid - continue - } - - mid, alreadyPartitioned := partitionCmpFunc(data, a, b, pivot, cmp) - wasPartitioned = alreadyPartitioned - - leftLen, rightLen := mid-a, b-mid - balanceThreshold := length / 8 - if leftLen < rightLen { - wasBalanced = leftLen >= balanceThreshold - pdqsortCmpFunc(data, a, mid, limit, cmp) - a = mid + 1 - } else { - wasBalanced = rightLen >= balanceThreshold - pdqsortCmpFunc(data, mid+1, b, limit, cmp) - b = mid - } - } -} - -// partitionCmpFunc does one quicksort partition. -// Let p = data[pivot] -// Moves elements in data[a:b] around, so that data[i]

=p for inewpivot. -// On return, data[newpivot] = p -func partitionCmpFunc[E any](data []E, a, b, pivot int, cmp func(a, b E) int) (newpivot int, alreadyPartitioned bool) { - data[a], data[pivot] = data[pivot], data[a] - i, j := a+1, b-1 // i and j are inclusive of the elements remaining to be partitioned - - for i <= j && (cmp(data[i], data[a]) < 0) { - i++ - } - for i <= j && !(cmp(data[j], data[a]) < 0) { - j-- - } - if i > j { - data[j], data[a] = data[a], data[j] - return j, true - } - data[i], data[j] = data[j], data[i] - i++ - j-- - - for { - for i <= j && (cmp(data[i], data[a]) < 0) { - i++ - } - for i <= j && !(cmp(data[j], data[a]) < 0) { - j-- - } - if i > j { - break - } - data[i], data[j] = data[j], data[i] - i++ - j-- - } - data[j], data[a] = data[a], data[j] - return j, false -} - -// partitionEqualCmpFunc partitions data[a:b] into elements equal to data[pivot] followed by elements greater than data[pivot]. -// It assumed that data[a:b] does not contain elements smaller than the data[pivot]. -func partitionEqualCmpFunc[E any](data []E, a, b, pivot int, cmp func(a, b E) int) (newpivot int) { - data[a], data[pivot] = data[pivot], data[a] - i, j := a+1, b-1 // i and j are inclusive of the elements remaining to be partitioned - - for { - for i <= j && !(cmp(data[a], data[i]) < 0) { - i++ - } - for i <= j && (cmp(data[a], data[j]) < 0) { - j-- - } - if i > j { - break - } - data[i], data[j] = data[j], data[i] - i++ - j-- - } - return i -} - -// partialInsertionSortCmpFunc partially sorts a slice, returns true if the slice is sorted at the end. -func partialInsertionSortCmpFunc[E any](data []E, a, b int, cmp func(a, b E) int) bool { - const ( - maxSteps = 5 // maximum number of adjacent out-of-order pairs that will get shifted - shortestShifting = 50 // don't shift any elements on short arrays - ) - i := a + 1 - for j := 0; j < maxSteps; j++ { - for i < b && !(cmp(data[i], data[i-1]) < 0) { - i++ - } - - if i == b { - return true - } - - if b-a < shortestShifting { - return false - } - - data[i], data[i-1] = data[i-1], data[i] - - // Shift the smaller one to the left. - if i-a >= 2 { - for j := i - 1; j >= 1; j-- { - if !(cmp(data[j], data[j-1]) < 0) { - break - } - data[j], data[j-1] = data[j-1], data[j] - } - } - // Shift the greater one to the right. - if b-i >= 2 { - for j := i + 1; j < b; j++ { - if !(cmp(data[j], data[j-1]) < 0) { - break - } - data[j], data[j-1] = data[j-1], data[j] - } - } - } - return false -} - -// breakPatternsCmpFunc scatters some elements around in an attempt to break some patterns -// that might cause imbalanced partitions in quicksort. -func breakPatternsCmpFunc[E any](data []E, a, b int, cmp func(a, b E) int) { - length := b - a - if length >= 8 { - random := xorshift(length) - modulus := nextPowerOfTwo(length) - - for idx := a + (length/4)*2 - 1; idx <= a+(length/4)*2+1; idx++ { - other := int(uint(random.Next()) & (modulus - 1)) - if other >= length { - other -= length - } - data[idx], data[a+other] = data[a+other], data[idx] - } - } -} - -// choosePivotCmpFunc chooses a pivot in data[a:b]. -// -// [0,8): chooses a static pivot. -// [8,shortestNinther): uses the simple median-of-three method. -// [shortestNinther,∞): uses the Tukey ninther method. -func choosePivotCmpFunc[E any](data []E, a, b int, cmp func(a, b E) int) (pivot int, hint sortedHint) { - const ( - shortestNinther = 50 - maxSwaps = 4 * 3 - ) - - l := b - a - - var ( - swaps int - i = a + l/4*1 - j = a + l/4*2 - k = a + l/4*3 - ) - - if l >= 8 { - if l >= shortestNinther { - // Tukey ninther method, the idea came from Rust's implementation. - i = medianAdjacentCmpFunc(data, i, &swaps, cmp) - j = medianAdjacentCmpFunc(data, j, &swaps, cmp) - k = medianAdjacentCmpFunc(data, k, &swaps, cmp) - } - // Find the median among i, j, k and stores it into j. - j = medianCmpFunc(data, i, j, k, &swaps, cmp) - } - - switch swaps { - case 0: - return j, increasingHint - case maxSwaps: - return j, decreasingHint - default: - return j, unknownHint - } -} - -// order2CmpFunc returns x,y where data[x] <= data[y], where x,y=a,b or x,y=b,a. -func order2CmpFunc[E any](data []E, a, b int, swaps *int, cmp func(a, b E) int) (int, int) { - if cmp(data[b], data[a]) < 0 { - *swaps++ - return b, a - } - return a, b -} - -// medianCmpFunc returns x where data[x] is the median of data[a],data[b],data[c], where x is a, b, or c. -func medianCmpFunc[E any](data []E, a, b, c int, swaps *int, cmp func(a, b E) int) int { - a, b = order2CmpFunc(data, a, b, swaps, cmp) - b, c = order2CmpFunc(data, b, c, swaps, cmp) - a, b = order2CmpFunc(data, a, b, swaps, cmp) - return b -} - -// medianAdjacentCmpFunc finds the median of data[a - 1], data[a], data[a + 1] and stores the index into a. -func medianAdjacentCmpFunc[E any](data []E, a int, swaps *int, cmp func(a, b E) int) int { - return medianCmpFunc(data, a-1, a, a+1, swaps, cmp) -} - -func reverseRangeCmpFunc[E any](data []E, a, b int, cmp func(a, b E) int) { - i := a - j := b - 1 - for i < j { - data[i], data[j] = data[j], data[i] - i++ - j-- - } -} - -func swapRangeCmpFunc[E any](data []E, a, b, n int, cmp func(a, b E) int) { - for i := 0; i < n; i++ { - data[a+i], data[b+i] = data[b+i], data[a+i] - } -} - -func stableCmpFunc[E any](data []E, n int, cmp func(a, b E) int) { - blockSize := 20 // must be > 0 - a, b := 0, blockSize - for b <= n { - insertionSortCmpFunc(data, a, b, cmp) - a = b - b += blockSize - } - insertionSortCmpFunc(data, a, n, cmp) - - for blockSize < n { - a, b = 0, 2*blockSize - for b <= n { - symMergeCmpFunc(data, a, a+blockSize, b, cmp) - a = b - b += 2 * blockSize - } - if m := a + blockSize; m < n { - symMergeCmpFunc(data, a, m, n, cmp) - } - blockSize *= 2 - } -} - -// symMergeCmpFunc merges the two sorted subsequences data[a:m] and data[m:b] using -// the SymMerge algorithm from Pok-Son Kim and Arne Kutzner, "Stable Minimum -// Storage Merging by Symmetric Comparisons", in Susanne Albers and Tomasz -// Radzik, editors, Algorithms - ESA 2004, volume 3221 of Lecture Notes in -// Computer Science, pages 714-723. Springer, 2004. -// -// Let M = m-a and N = b-n. Wolog M < N. -// The recursion depth is bound by ceil(log(N+M)). -// The algorithm needs O(M*log(N/M + 1)) calls to data.Less. -// The algorithm needs O((M+N)*log(M)) calls to data.Swap. -// -// The paper gives O((M+N)*log(M)) as the number of assignments assuming a -// rotation algorithm which uses O(M+N+gcd(M+N)) assignments. The argumentation -// in the paper carries through for Swap operations, especially as the block -// swapping rotate uses only O(M+N) Swaps. -// -// symMerge assumes non-degenerate arguments: a < m && m < b. -// Having the caller check this condition eliminates many leaf recursion calls, -// which improves performance. -func symMergeCmpFunc[E any](data []E, a, m, b int, cmp func(a, b E) int) { - // Avoid unnecessary recursions of symMerge - // by direct insertion of data[a] into data[m:b] - // if data[a:m] only contains one element. - if m-a == 1 { - // Use binary search to find the lowest index i - // such that data[i] >= data[a] for m <= i < b. - // Exit the search loop with i == b in case no such index exists. - i := m - j := b - for i < j { - h := int(uint(i+j) >> 1) - if cmp(data[h], data[a]) < 0 { - i = h + 1 - } else { - j = h - } - } - // Swap values until data[a] reaches the position before i. - for k := a; k < i-1; k++ { - data[k], data[k+1] = data[k+1], data[k] - } - return - } - - // Avoid unnecessary recursions of symMerge - // by direct insertion of data[m] into data[a:m] - // if data[m:b] only contains one element. - if b-m == 1 { - // Use binary search to find the lowest index i - // such that data[i] > data[m] for a <= i < m. - // Exit the search loop with i == m in case no such index exists. - i := a - j := m - for i < j { - h := int(uint(i+j) >> 1) - if !(cmp(data[m], data[h]) < 0) { - i = h + 1 - } else { - j = h - } - } - // Swap values until data[m] reaches the position i. - for k := m; k > i; k-- { - data[k], data[k-1] = data[k-1], data[k] - } - return - } - - mid := int(uint(a+b) >> 1) - n := mid + m - var start, r int - if m > mid { - start = n - b - r = mid - } else { - start = a - r = m - } - p := n - 1 - - for start < r { - c := int(uint(start+r) >> 1) - if !(cmp(data[p-c], data[c]) < 0) { - start = c + 1 - } else { - r = c - } - } - - end := n - start - if start < m && m < end { - rotateCmpFunc(data, start, m, end, cmp) - } - if a < start && start < mid { - symMergeCmpFunc(data, a, start, mid, cmp) - } - if mid < end && end < b { - symMergeCmpFunc(data, mid, end, b, cmp) - } -} - -// rotateCmpFunc rotates two consecutive blocks u = data[a:m] and v = data[m:b] in data: -// Data of the form 'x u v y' is changed to 'x v u y'. -// rotate performs at most b-a many calls to data.Swap, -// and it assumes non-degenerate arguments: a < m && m < b. -func rotateCmpFunc[E any](data []E, a, m, b int, cmp func(a, b E) int) { - i := m - a - j := b - m - - for i != j { - if i > j { - swapRangeCmpFunc(data, m-i, m, j, cmp) - i -= j - } else { - swapRangeCmpFunc(data, m-i, m+j-i, i, cmp) - j -= i - } - } - // i == j - swapRangeCmpFunc(data, m-i, m, i, cmp) -} diff --git a/vendor/golang.org/x/exp/slices/zsortordered.go b/vendor/golang.org/x/exp/slices/zsortordered.go deleted file mode 100644 index 99b47c3986a..00000000000 --- a/vendor/golang.org/x/exp/slices/zsortordered.go +++ /dev/null @@ -1,481 +0,0 @@ -// Code generated by gen_sort_variants.go; DO NOT EDIT. - -// Copyright 2022 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package slices - -import "golang.org/x/exp/constraints" - -// insertionSortOrdered sorts data[a:b] using insertion sort. -func insertionSortOrdered[E constraints.Ordered](data []E, a, b int) { - for i := a + 1; i < b; i++ { - for j := i; j > a && cmpLess(data[j], data[j-1]); j-- { - data[j], data[j-1] = data[j-1], data[j] - } - } -} - -// siftDownOrdered implements the heap property on data[lo:hi]. -// first is an offset into the array where the root of the heap lies. -func siftDownOrdered[E constraints.Ordered](data []E, lo, hi, first int) { - root := lo - for { - child := 2*root + 1 - if child >= hi { - break - } - if child+1 < hi && cmpLess(data[first+child], data[first+child+1]) { - child++ - } - if !cmpLess(data[first+root], data[first+child]) { - return - } - data[first+root], data[first+child] = data[first+child], data[first+root] - root = child - } -} - -func heapSortOrdered[E constraints.Ordered](data []E, a, b int) { - first := a - lo := 0 - hi := b - a - - // Build heap with greatest element at top. - for i := (hi - 1) / 2; i >= 0; i-- { - siftDownOrdered(data, i, hi, first) - } - - // Pop elements, largest first, into end of data. - for i := hi - 1; i >= 0; i-- { - data[first], data[first+i] = data[first+i], data[first] - siftDownOrdered(data, lo, i, first) - } -} - -// pdqsortOrdered sorts data[a:b]. -// The algorithm based on pattern-defeating quicksort(pdqsort), but without the optimizations from BlockQuicksort. -// pdqsort paper: https://arxiv.org/pdf/2106.05123.pdf -// C++ implementation: https://github.com/orlp/pdqsort -// Rust implementation: https://docs.rs/pdqsort/latest/pdqsort/ -// limit is the number of allowed bad (very unbalanced) pivots before falling back to heapsort. -func pdqsortOrdered[E constraints.Ordered](data []E, a, b, limit int) { - const maxInsertion = 12 - - var ( - wasBalanced = true // whether the last partitioning was reasonably balanced - wasPartitioned = true // whether the slice was already partitioned - ) - - for { - length := b - a - - if length <= maxInsertion { - insertionSortOrdered(data, a, b) - return - } - - // Fall back to heapsort if too many bad choices were made. - if limit == 0 { - heapSortOrdered(data, a, b) - return - } - - // If the last partitioning was imbalanced, we need to breaking patterns. - if !wasBalanced { - breakPatternsOrdered(data, a, b) - limit-- - } - - pivot, hint := choosePivotOrdered(data, a, b) - if hint == decreasingHint { - reverseRangeOrdered(data, a, b) - // The chosen pivot was pivot-a elements after the start of the array. - // After reversing it is pivot-a elements before the end of the array. - // The idea came from Rust's implementation. - pivot = (b - 1) - (pivot - a) - hint = increasingHint - } - - // The slice is likely already sorted. - if wasBalanced && wasPartitioned && hint == increasingHint { - if partialInsertionSortOrdered(data, a, b) { - return - } - } - - // Probably the slice contains many duplicate elements, partition the slice into - // elements equal to and elements greater than the pivot. - if a > 0 && !cmpLess(data[a-1], data[pivot]) { - mid := partitionEqualOrdered(data, a, b, pivot) - a = mid - continue - } - - mid, alreadyPartitioned := partitionOrdered(data, a, b, pivot) - wasPartitioned = alreadyPartitioned - - leftLen, rightLen := mid-a, b-mid - balanceThreshold := length / 8 - if leftLen < rightLen { - wasBalanced = leftLen >= balanceThreshold - pdqsortOrdered(data, a, mid, limit) - a = mid + 1 - } else { - wasBalanced = rightLen >= balanceThreshold - pdqsortOrdered(data, mid+1, b, limit) - b = mid - } - } -} - -// partitionOrdered does one quicksort partition. -// Let p = data[pivot] -// Moves elements in data[a:b] around, so that data[i]

=p for inewpivot. -// On return, data[newpivot] = p -func partitionOrdered[E constraints.Ordered](data []E, a, b, pivot int) (newpivot int, alreadyPartitioned bool) { - data[a], data[pivot] = data[pivot], data[a] - i, j := a+1, b-1 // i and j are inclusive of the elements remaining to be partitioned - - for i <= j && cmpLess(data[i], data[a]) { - i++ - } - for i <= j && !cmpLess(data[j], data[a]) { - j-- - } - if i > j { - data[j], data[a] = data[a], data[j] - return j, true - } - data[i], data[j] = data[j], data[i] - i++ - j-- - - for { - for i <= j && cmpLess(data[i], data[a]) { - i++ - } - for i <= j && !cmpLess(data[j], data[a]) { - j-- - } - if i > j { - break - } - data[i], data[j] = data[j], data[i] - i++ - j-- - } - data[j], data[a] = data[a], data[j] - return j, false -} - -// partitionEqualOrdered partitions data[a:b] into elements equal to data[pivot] followed by elements greater than data[pivot]. -// It assumed that data[a:b] does not contain elements smaller than the data[pivot]. -func partitionEqualOrdered[E constraints.Ordered](data []E, a, b, pivot int) (newpivot int) { - data[a], data[pivot] = data[pivot], data[a] - i, j := a+1, b-1 // i and j are inclusive of the elements remaining to be partitioned - - for { - for i <= j && !cmpLess(data[a], data[i]) { - i++ - } - for i <= j && cmpLess(data[a], data[j]) { - j-- - } - if i > j { - break - } - data[i], data[j] = data[j], data[i] - i++ - j-- - } - return i -} - -// partialInsertionSortOrdered partially sorts a slice, returns true if the slice is sorted at the end. -func partialInsertionSortOrdered[E constraints.Ordered](data []E, a, b int) bool { - const ( - maxSteps = 5 // maximum number of adjacent out-of-order pairs that will get shifted - shortestShifting = 50 // don't shift any elements on short arrays - ) - i := a + 1 - for j := 0; j < maxSteps; j++ { - for i < b && !cmpLess(data[i], data[i-1]) { - i++ - } - - if i == b { - return true - } - - if b-a < shortestShifting { - return false - } - - data[i], data[i-1] = data[i-1], data[i] - - // Shift the smaller one to the left. - if i-a >= 2 { - for j := i - 1; j >= 1; j-- { - if !cmpLess(data[j], data[j-1]) { - break - } - data[j], data[j-1] = data[j-1], data[j] - } - } - // Shift the greater one to the right. - if b-i >= 2 { - for j := i + 1; j < b; j++ { - if !cmpLess(data[j], data[j-1]) { - break - } - data[j], data[j-1] = data[j-1], data[j] - } - } - } - return false -} - -// breakPatternsOrdered scatters some elements around in an attempt to break some patterns -// that might cause imbalanced partitions in quicksort. -func breakPatternsOrdered[E constraints.Ordered](data []E, a, b int) { - length := b - a - if length >= 8 { - random := xorshift(length) - modulus := nextPowerOfTwo(length) - - for idx := a + (length/4)*2 - 1; idx <= a+(length/4)*2+1; idx++ { - other := int(uint(random.Next()) & (modulus - 1)) - if other >= length { - other -= length - } - data[idx], data[a+other] = data[a+other], data[idx] - } - } -} - -// choosePivotOrdered chooses a pivot in data[a:b]. -// -// [0,8): chooses a static pivot. -// [8,shortestNinther): uses the simple median-of-three method. -// [shortestNinther,∞): uses the Tukey ninther method. -func choosePivotOrdered[E constraints.Ordered](data []E, a, b int) (pivot int, hint sortedHint) { - const ( - shortestNinther = 50 - maxSwaps = 4 * 3 - ) - - l := b - a - - var ( - swaps int - i = a + l/4*1 - j = a + l/4*2 - k = a + l/4*3 - ) - - if l >= 8 { - if l >= shortestNinther { - // Tukey ninther method, the idea came from Rust's implementation. - i = medianAdjacentOrdered(data, i, &swaps) - j = medianAdjacentOrdered(data, j, &swaps) - k = medianAdjacentOrdered(data, k, &swaps) - } - // Find the median among i, j, k and stores it into j. - j = medianOrdered(data, i, j, k, &swaps) - } - - switch swaps { - case 0: - return j, increasingHint - case maxSwaps: - return j, decreasingHint - default: - return j, unknownHint - } -} - -// order2Ordered returns x,y where data[x] <= data[y], where x,y=a,b or x,y=b,a. -func order2Ordered[E constraints.Ordered](data []E, a, b int, swaps *int) (int, int) { - if cmpLess(data[b], data[a]) { - *swaps++ - return b, a - } - return a, b -} - -// medianOrdered returns x where data[x] is the median of data[a],data[b],data[c], where x is a, b, or c. -func medianOrdered[E constraints.Ordered](data []E, a, b, c int, swaps *int) int { - a, b = order2Ordered(data, a, b, swaps) - b, c = order2Ordered(data, b, c, swaps) - a, b = order2Ordered(data, a, b, swaps) - return b -} - -// medianAdjacentOrdered finds the median of data[a - 1], data[a], data[a + 1] and stores the index into a. -func medianAdjacentOrdered[E constraints.Ordered](data []E, a int, swaps *int) int { - return medianOrdered(data, a-1, a, a+1, swaps) -} - -func reverseRangeOrdered[E constraints.Ordered](data []E, a, b int) { - i := a - j := b - 1 - for i < j { - data[i], data[j] = data[j], data[i] - i++ - j-- - } -} - -func swapRangeOrdered[E constraints.Ordered](data []E, a, b, n int) { - for i := 0; i < n; i++ { - data[a+i], data[b+i] = data[b+i], data[a+i] - } -} - -func stableOrdered[E constraints.Ordered](data []E, n int) { - blockSize := 20 // must be > 0 - a, b := 0, blockSize - for b <= n { - insertionSortOrdered(data, a, b) - a = b - b += blockSize - } - insertionSortOrdered(data, a, n) - - for blockSize < n { - a, b = 0, 2*blockSize - for b <= n { - symMergeOrdered(data, a, a+blockSize, b) - a = b - b += 2 * blockSize - } - if m := a + blockSize; m < n { - symMergeOrdered(data, a, m, n) - } - blockSize *= 2 - } -} - -// symMergeOrdered merges the two sorted subsequences data[a:m] and data[m:b] using -// the SymMerge algorithm from Pok-Son Kim and Arne Kutzner, "Stable Minimum -// Storage Merging by Symmetric Comparisons", in Susanne Albers and Tomasz -// Radzik, editors, Algorithms - ESA 2004, volume 3221 of Lecture Notes in -// Computer Science, pages 714-723. Springer, 2004. -// -// Let M = m-a and N = b-n. Wolog M < N. -// The recursion depth is bound by ceil(log(N+M)). -// The algorithm needs O(M*log(N/M + 1)) calls to data.Less. -// The algorithm needs O((M+N)*log(M)) calls to data.Swap. -// -// The paper gives O((M+N)*log(M)) as the number of assignments assuming a -// rotation algorithm which uses O(M+N+gcd(M+N)) assignments. The argumentation -// in the paper carries through for Swap operations, especially as the block -// swapping rotate uses only O(M+N) Swaps. -// -// symMerge assumes non-degenerate arguments: a < m && m < b. -// Having the caller check this condition eliminates many leaf recursion calls, -// which improves performance. -func symMergeOrdered[E constraints.Ordered](data []E, a, m, b int) { - // Avoid unnecessary recursions of symMerge - // by direct insertion of data[a] into data[m:b] - // if data[a:m] only contains one element. - if m-a == 1 { - // Use binary search to find the lowest index i - // such that data[i] >= data[a] for m <= i < b. - // Exit the search loop with i == b in case no such index exists. - i := m - j := b - for i < j { - h := int(uint(i+j) >> 1) - if cmpLess(data[h], data[a]) { - i = h + 1 - } else { - j = h - } - } - // Swap values until data[a] reaches the position before i. - for k := a; k < i-1; k++ { - data[k], data[k+1] = data[k+1], data[k] - } - return - } - - // Avoid unnecessary recursions of symMerge - // by direct insertion of data[m] into data[a:m] - // if data[m:b] only contains one element. - if b-m == 1 { - // Use binary search to find the lowest index i - // such that data[i] > data[m] for a <= i < m. - // Exit the search loop with i == m in case no such index exists. - i := a - j := m - for i < j { - h := int(uint(i+j) >> 1) - if !cmpLess(data[m], data[h]) { - i = h + 1 - } else { - j = h - } - } - // Swap values until data[m] reaches the position i. - for k := m; k > i; k-- { - data[k], data[k-1] = data[k-1], data[k] - } - return - } - - mid := int(uint(a+b) >> 1) - n := mid + m - var start, r int - if m > mid { - start = n - b - r = mid - } else { - start = a - r = m - } - p := n - 1 - - for start < r { - c := int(uint(start+r) >> 1) - if !cmpLess(data[p-c], data[c]) { - start = c + 1 - } else { - r = c - } - } - - end := n - start - if start < m && m < end { - rotateOrdered(data, start, m, end) - } - if a < start && start < mid { - symMergeOrdered(data, a, start, mid) - } - if mid < end && end < b { - symMergeOrdered(data, mid, end, b) - } -} - -// rotateOrdered rotates two consecutive blocks u = data[a:m] and v = data[m:b] in data: -// Data of the form 'x u v y' is changed to 'x v u y'. -// rotate performs at most b-a many calls to data.Swap, -// and it assumes non-degenerate arguments: a < m && m < b. -func rotateOrdered[E constraints.Ordered](data []E, a, m, b int) { - i := m - a - j := b - m - - for i != j { - if i > j { - swapRangeOrdered(data, m-i, m, j) - i -= j - } else { - swapRangeOrdered(data, m-i, m+j-i, i) - j -= i - } - } - // i == j - swapRangeOrdered(data, m-i, m, i) -} diff --git a/vendor/golang.org/x/oauth2/google/default.go b/vendor/golang.org/x/oauth2/google/default.go index df958359a87..0260935bab7 100644 --- a/vendor/golang.org/x/oauth2/google/default.go +++ b/vendor/golang.org/x/oauth2/google/default.go @@ -251,6 +251,12 @@ func FindDefaultCredentials(ctx context.Context, scopes ...string) (*Credentials // a Google Developers service account key file, a gcloud user credentials file (a.k.a. refresh // token JSON), or the JSON configuration file for workload identity federation in non-Google cloud // platforms (see https://cloud.google.com/iam/docs/how-to#using-workload-identity-federation). +// +// Important: If you accept a credential configuration (credential JSON/File/Stream) from an +// external source for authentication to Google Cloud Platform, you must validate it before +// providing it to any Google API or library. Providing an unvalidated credential configuration to +// Google APIs can compromise the security of your systems and data. For more information, refer to +// [Validate credential configurations from external sources](https://cloud.google.com/docs/authentication/external/externally-sourced-credentials). func CredentialsFromJSONWithParams(ctx context.Context, jsonData []byte, params CredentialsParams) (*Credentials, error) { // Make defensive copy of the slices in params. params = params.deepCopy() @@ -294,6 +300,12 @@ func CredentialsFromJSONWithParams(ctx context.Context, jsonData []byte, params } // CredentialsFromJSON invokes CredentialsFromJSONWithParams with the specified scopes. +// +// Important: If you accept a credential configuration (credential JSON/File/Stream) from an +// external source for authentication to Google Cloud Platform, you must validate it before +// providing it to any Google API or library. Providing an unvalidated credential configuration to +// Google APIs can compromise the security of your systems and data. For more information, refer to +// [Validate credential configurations from external sources](https://cloud.google.com/docs/authentication/external/externally-sourced-credentials). func CredentialsFromJSON(ctx context.Context, jsonData []byte, scopes ...string) (*Credentials, error) { var params CredentialsParams params.Scopes = scopes diff --git a/vendor/golang.org/x/oauth2/google/externalaccount/basecredentials.go b/vendor/golang.org/x/oauth2/google/externalaccount/basecredentials.go index ee34924e301..fc106347d85 100644 --- a/vendor/golang.org/x/oauth2/google/externalaccount/basecredentials.go +++ b/vendor/golang.org/x/oauth2/google/externalaccount/basecredentials.go @@ -278,20 +278,52 @@ type Format struct { type CredentialSource struct { // File is the location for file sourced credentials. // One field amongst File, URL, Executable, or EnvironmentID should be provided, depending on the kind of credential in question. + // + // Important: If you accept a credential configuration (credential + // JSON/File/Stream) from an external source for authentication to Google + // Cloud Platform, you must validate it before providing it to any Google + // API or library. Providing an unvalidated credential configuration to + // Google APIs can compromise the security of your systems and data. For + // more information, refer to [Validate credential configurations from + // external sources](https://cloud.google.com/docs/authentication/external/externally-sourced-credentials). File string `json:"file"` // Url is the URL to call for URL sourced credentials. // One field amongst File, URL, Executable, or EnvironmentID should be provided, depending on the kind of credential in question. + // + // Important: If you accept a credential configuration (credential + // JSON/File/Stream) from an external source for authentication to Google + // Cloud Platform, you must validate it before providing it to any Google + // API or library. Providing an unvalidated credential configuration to + // Google APIs can compromise the security of your systems and data. For + // more information, refer to [Validate credential configurations from + // external sources](https://cloud.google.com/docs/authentication/external/externally-sourced-credentials). URL string `json:"url"` // Headers are the headers to attach to the request for URL sourced credentials. Headers map[string]string `json:"headers"` // Executable is the configuration object for executable sourced credentials. // One field amongst File, URL, Executable, or EnvironmentID should be provided, depending on the kind of credential in question. + // + // Important: If you accept a credential configuration (credential + // JSON/File/Stream) from an external source for authentication to Google + // Cloud Platform, you must validate it before providing it to any Google + // API or library. Providing an unvalidated credential configuration to + // Google APIs can compromise the security of your systems and data. For + // more information, refer to [Validate credential configurations from + // external sources](https://cloud.google.com/docs/authentication/external/externally-sourced-credentials). Executable *ExecutableConfig `json:"executable"` // EnvironmentID is the EnvironmentID used for AWS sourced credentials. This should start with "AWS". // One field amongst File, URL, Executable, or EnvironmentID should be provided, depending on the kind of credential in question. + // + // Important: If you accept a credential configuration (credential + // JSON/File/Stream) from an external source for authentication to Google + // Cloud Platform, you must validate it before providing it to any Google + // API or library. Providing an unvalidated credential configuration to + // Google APIs can compromise the security of your systems and data. For + // more information, refer to [Validate credential configurations from + // external sources](https://cloud.google.com/docs/authentication/external/externally-sourced-credentials). EnvironmentID string `json:"environment_id"` // RegionURL is the metadata URL to retrieve the region from for EC2 AWS credentials. RegionURL string `json:"region_url"` diff --git a/vendor/golang.org/x/sync/errgroup/errgroup.go b/vendor/golang.org/x/sync/errgroup/errgroup.go index a4ea5d14f15..f8c3c092658 100644 --- a/vendor/golang.org/x/sync/errgroup/errgroup.go +++ b/vendor/golang.org/x/sync/errgroup/errgroup.go @@ -18,7 +18,7 @@ import ( type token struct{} // A Group is a collection of goroutines working on subtasks that are part of -// the same overall task. +// the same overall task. A Group should not be reused for different tasks. // // A zero Group is valid, has no limit on the number of active goroutines, // and does not cancel on error. @@ -61,6 +61,7 @@ func (g *Group) Wait() error { } // Go calls the given function in a new goroutine. +// The first call to Go must happen before a Wait. // It blocks until the new goroutine can be added without the number of // active goroutines in the group exceeding the configured limit. // diff --git a/vendor/golang.org/x/sys/cpu/cpu.go b/vendor/golang.org/x/sys/cpu/cpu.go index 9c105f23afc..2e73ee19752 100644 --- a/vendor/golang.org/x/sys/cpu/cpu.go +++ b/vendor/golang.org/x/sys/cpu/cpu.go @@ -149,6 +149,18 @@ var ARM struct { _ CacheLinePad } +// The booleans in Loong64 contain the correspondingly named cpu feature bit. +// The struct is padded to avoid false sharing. +var Loong64 struct { + _ CacheLinePad + HasLSX bool // support 128-bit vector extension + HasLASX bool // support 256-bit vector extension + HasCRC32 bool // support CRC instruction + HasLAM_BH bool // support AM{SWAP/ADD}[_DB].{B/H} instruction + HasLAMCAS bool // support AMCAS[_DB].{B/H/W/D} instruction + _ CacheLinePad +} + // MIPS64X contains the supported CPU features of the current mips64/mips64le // platforms. If the current platform is not mips64/mips64le or the current // operating system is not Linux then all feature flags are false. diff --git a/vendor/golang.org/x/sys/cpu/cpu_linux_loong64.go b/vendor/golang.org/x/sys/cpu/cpu_linux_loong64.go new file mode 100644 index 00000000000..4f34114329e --- /dev/null +++ b/vendor/golang.org/x/sys/cpu/cpu_linux_loong64.go @@ -0,0 +1,22 @@ +// Copyright 2025 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package cpu + +// HWCAP bits. These are exposed by the Linux kernel. +const ( + hwcap_LOONGARCH_LSX = 1 << 4 + hwcap_LOONGARCH_LASX = 1 << 5 +) + +func doinit() { + // TODO: Features that require kernel support like LSX and LASX can + // be detected here once needed in std library or by the compiler. + Loong64.HasLSX = hwcIsSet(hwCap, hwcap_LOONGARCH_LSX) + Loong64.HasLASX = hwcIsSet(hwCap, hwcap_LOONGARCH_LASX) +} + +func hwcIsSet(hwc uint, val uint) bool { + return hwc&val != 0 +} diff --git a/vendor/golang.org/x/sys/cpu/cpu_linux_noinit.go b/vendor/golang.org/x/sys/cpu/cpu_linux_noinit.go index 7d902b6847b..a428dec9cde 100644 --- a/vendor/golang.org/x/sys/cpu/cpu_linux_noinit.go +++ b/vendor/golang.org/x/sys/cpu/cpu_linux_noinit.go @@ -2,7 +2,7 @@ // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. -//go:build linux && !arm && !arm64 && !mips64 && !mips64le && !ppc64 && !ppc64le && !s390x && !riscv64 +//go:build linux && !arm && !arm64 && !loong64 && !mips64 && !mips64le && !ppc64 && !ppc64le && !s390x && !riscv64 package cpu diff --git a/vendor/golang.org/x/sys/cpu/cpu_loong64.go b/vendor/golang.org/x/sys/cpu/cpu_loong64.go index 558635850c7..45ecb29ae78 100644 --- a/vendor/golang.org/x/sys/cpu/cpu_loong64.go +++ b/vendor/golang.org/x/sys/cpu/cpu_loong64.go @@ -8,5 +8,43 @@ package cpu const cacheLineSize = 64 +// Bit fields for CPUCFG registers, Related reference documents: +// https://loongson.github.io/LoongArch-Documentation/LoongArch-Vol1-EN.html#_cpucfg +const ( + // CPUCFG1 bits + cpucfg1_CRC32 = 1 << 25 + + // CPUCFG2 bits + cpucfg2_LAM_BH = 1 << 27 + cpucfg2_LAMCAS = 1 << 28 +) + func initOptions() { + options = []option{ + {Name: "lsx", Feature: &Loong64.HasLSX}, + {Name: "lasx", Feature: &Loong64.HasLASX}, + {Name: "crc32", Feature: &Loong64.HasCRC32}, + {Name: "lam_bh", Feature: &Loong64.HasLAM_BH}, + {Name: "lamcas", Feature: &Loong64.HasLAMCAS}, + } + + // The CPUCFG data on Loong64 only reflects the hardware capabilities, + // not the kernel support status, so features such as LSX and LASX that + // require kernel support cannot be obtained from the CPUCFG data. + // + // These features only require hardware capability support and do not + // require kernel specific support, so they can be obtained directly + // through CPUCFG + cfg1 := get_cpucfg(1) + cfg2 := get_cpucfg(2) + + Loong64.HasCRC32 = cfgIsSet(cfg1, cpucfg1_CRC32) + Loong64.HasLAMCAS = cfgIsSet(cfg2, cpucfg2_LAMCAS) + Loong64.HasLAM_BH = cfgIsSet(cfg2, cpucfg2_LAM_BH) +} + +func get_cpucfg(reg uint32) uint32 + +func cfgIsSet(cfg uint32, val uint32) bool { + return cfg&val != 0 } diff --git a/vendor/golang.org/x/sys/cpu/cpu_loong64.s b/vendor/golang.org/x/sys/cpu/cpu_loong64.s new file mode 100644 index 00000000000..71cbaf1ce27 --- /dev/null +++ b/vendor/golang.org/x/sys/cpu/cpu_loong64.s @@ -0,0 +1,13 @@ +// Copyright 2025 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +#include "textflag.h" + +// func get_cpucfg(reg uint32) uint32 +TEXT ·get_cpucfg(SB), NOSPLIT|NOFRAME, $0 + MOVW reg+0(FP), R5 + // CPUCFG R5, R4 = 0x00006ca4 + WORD $0x00006ca4 + MOVW R4, ret+8(FP) + RET diff --git a/vendor/golang.org/x/sys/cpu/parse.go b/vendor/golang.org/x/sys/cpu/parse.go index 762b63d6882..56a7e1a176f 100644 --- a/vendor/golang.org/x/sys/cpu/parse.go +++ b/vendor/golang.org/x/sys/cpu/parse.go @@ -13,7 +13,7 @@ import "strconv" // https://golang.org/cl/209597. func parseRelease(rel string) (major, minor, patch int, ok bool) { // Strip anything after a dash or plus. - for i := 0; i < len(rel); i++ { + for i := range len(rel) { if rel[i] == '-' || rel[i] == '+' { rel = rel[:i] break @@ -21,7 +21,7 @@ func parseRelease(rel string) (major, minor, patch int, ok bool) { } next := func() (int, bool) { - for i := 0; i < len(rel); i++ { + for i := range len(rel) { if rel[i] == '.' { ver, err := strconv.Atoi(rel[:i]) rel = rel[i+1:] diff --git a/vendor/golang.org/x/sys/unix/syscall_darwin.go b/vendor/golang.org/x/sys/unix/syscall_darwin.go index 099867deede..798f61ad3bf 100644 --- a/vendor/golang.org/x/sys/unix/syscall_darwin.go +++ b/vendor/golang.org/x/sys/unix/syscall_darwin.go @@ -602,7 +602,150 @@ func Connectx(fd int, srcIf uint32, srcAddr, dstAddr Sockaddr, associd SaeAssocI return } -//sys connectx(fd int, endpoints *SaEndpoints, associd SaeAssocID, flags uint32, iov []Iovec, n *uintptr, connid *SaeConnID) (err error) +// sys connectx(fd int, endpoints *SaEndpoints, associd SaeAssocID, flags uint32, iov []Iovec, n *uintptr, connid *SaeConnID) (err error) +const minIovec = 8 + +func Readv(fd int, iovs [][]byte) (n int, err error) { + if !darwinKernelVersionMin(11, 0, 0) { + return 0, ENOSYS + } + + iovecs := make([]Iovec, 0, minIovec) + iovecs = appendBytes(iovecs, iovs) + n, err = readv(fd, iovecs) + readvRacedetect(iovecs, n, err) + return n, err +} + +func Preadv(fd int, iovs [][]byte, offset int64) (n int, err error) { + if !darwinKernelVersionMin(11, 0, 0) { + return 0, ENOSYS + } + iovecs := make([]Iovec, 0, minIovec) + iovecs = appendBytes(iovecs, iovs) + n, err = preadv(fd, iovecs, offset) + readvRacedetect(iovecs, n, err) + return n, err +} + +func Writev(fd int, iovs [][]byte) (n int, err error) { + if !darwinKernelVersionMin(11, 0, 0) { + return 0, ENOSYS + } + + iovecs := make([]Iovec, 0, minIovec) + iovecs = appendBytes(iovecs, iovs) + if raceenabled { + raceReleaseMerge(unsafe.Pointer(&ioSync)) + } + n, err = writev(fd, iovecs) + writevRacedetect(iovecs, n) + return n, err +} + +func Pwritev(fd int, iovs [][]byte, offset int64) (n int, err error) { + if !darwinKernelVersionMin(11, 0, 0) { + return 0, ENOSYS + } + + iovecs := make([]Iovec, 0, minIovec) + iovecs = appendBytes(iovecs, iovs) + if raceenabled { + raceReleaseMerge(unsafe.Pointer(&ioSync)) + } + n, err = pwritev(fd, iovecs, offset) + writevRacedetect(iovecs, n) + return n, err +} + +func appendBytes(vecs []Iovec, bs [][]byte) []Iovec { + for _, b := range bs { + var v Iovec + v.SetLen(len(b)) + if len(b) > 0 { + v.Base = &b[0] + } else { + v.Base = (*byte)(unsafe.Pointer(&_zero)) + } + vecs = append(vecs, v) + } + return vecs +} + +func writevRacedetect(iovecs []Iovec, n int) { + if !raceenabled { + return + } + for i := 0; n > 0 && i < len(iovecs); i++ { + m := int(iovecs[i].Len) + if m > n { + m = n + } + n -= m + if m > 0 { + raceReadRange(unsafe.Pointer(iovecs[i].Base), m) + } + } +} + +func readvRacedetect(iovecs []Iovec, n int, err error) { + if !raceenabled { + return + } + for i := 0; n > 0 && i < len(iovecs); i++ { + m := int(iovecs[i].Len) + if m > n { + m = n + } + n -= m + if m > 0 { + raceWriteRange(unsafe.Pointer(iovecs[i].Base), m) + } + } + if err == nil { + raceAcquire(unsafe.Pointer(&ioSync)) + } +} + +func darwinMajorMinPatch() (maj, min, patch int, err error) { + var un Utsname + err = Uname(&un) + if err != nil { + return + } + + var mmp [3]int + c := 0 +Loop: + for _, b := range un.Release[:] { + switch { + case b >= '0' && b <= '9': + mmp[c] = 10*mmp[c] + int(b-'0') + case b == '.': + c++ + if c > 2 { + return 0, 0, 0, ENOTSUP + } + case b == 0: + break Loop + default: + return 0, 0, 0, ENOTSUP + } + } + if c != 2 { + return 0, 0, 0, ENOTSUP + } + return mmp[0], mmp[1], mmp[2], nil +} + +func darwinKernelVersionMin(maj, min, patch int) bool { + actualMaj, actualMin, actualPatch, err := darwinMajorMinPatch() + if err != nil { + return false + } + return actualMaj > maj || actualMaj == maj && (actualMin > min || actualMin == min && actualPatch >= patch) +} + //sys sendfile(infd int, outfd int, offset int64, len *int64, hdtr unsafe.Pointer, flags int) (err error) //sys shmat(id int, addr uintptr, flag int) (ret uintptr, err error) @@ -705,3 +848,7 @@ func Connectx(fd int, srcIf uint32, srcAddr, dstAddr Sockaddr, associd SaeAssocI //sys write(fd int, p []byte) (n int, err error) //sys mmap(addr uintptr, length uintptr, prot int, flag int, fd int, pos int64) (ret uintptr, err error) //sys munmap(addr uintptr, length uintptr) (err error) +//sys readv(fd int, iovecs []Iovec) (n int, err error) +//sys preadv(fd int, iovecs []Iovec, offset int64) (n int, err error) +//sys writev(fd int, iovecs []Iovec) (n int, err error) +//sys pwritev(fd int, iovecs []Iovec, offset int64) (n int, err error) diff --git a/vendor/golang.org/x/sys/unix/syscall_linux.go b/vendor/golang.org/x/sys/unix/syscall_linux.go index 230a94549a7..4958a657085 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux.go @@ -13,6 +13,7 @@ package unix import ( "encoding/binary" + "slices" "strconv" "syscall" "time" @@ -417,7 +418,7 @@ func (sa *SockaddrUnix) sockaddr() (unsafe.Pointer, _Socklen, error) { return nil, 0, EINVAL } sa.raw.Family = AF_UNIX - for i := 0; i < n; i++ { + for i := range n { sa.raw.Path[i] = int8(name[i]) } // length is family (uint16), name, NUL. @@ -507,7 +508,7 @@ func (sa *SockaddrL2) sockaddr() (unsafe.Pointer, _Socklen, error) { psm := (*[2]byte)(unsafe.Pointer(&sa.raw.Psm)) psm[0] = byte(sa.PSM) psm[1] = byte(sa.PSM >> 8) - for i := 0; i < len(sa.Addr); i++ { + for i := range len(sa.Addr) { sa.raw.Bdaddr[i] = sa.Addr[len(sa.Addr)-1-i] } cid := (*[2]byte)(unsafe.Pointer(&sa.raw.Cid)) @@ -589,11 +590,11 @@ func (sa *SockaddrCAN) sockaddr() (unsafe.Pointer, _Socklen, error) { sa.raw.Family = AF_CAN sa.raw.Ifindex = int32(sa.Ifindex) rx := (*[4]byte)(unsafe.Pointer(&sa.RxID)) - for i := 0; i < 4; i++ { + for i := range 4 { sa.raw.Addr[i] = rx[i] } tx := (*[4]byte)(unsafe.Pointer(&sa.TxID)) - for i := 0; i < 4; i++ { + for i := range 4 { sa.raw.Addr[i+4] = tx[i] } return unsafe.Pointer(&sa.raw), SizeofSockaddrCAN, nil @@ -618,11 +619,11 @@ func (sa *SockaddrCANJ1939) sockaddr() (unsafe.Pointer, _Socklen, error) { sa.raw.Family = AF_CAN sa.raw.Ifindex = int32(sa.Ifindex) n := (*[8]byte)(unsafe.Pointer(&sa.Name)) - for i := 0; i < 8; i++ { + for i := range 8 { sa.raw.Addr[i] = n[i] } p := (*[4]byte)(unsafe.Pointer(&sa.PGN)) - for i := 0; i < 4; i++ { + for i := range 4 { sa.raw.Addr[i+8] = p[i] } sa.raw.Addr[12] = sa.Addr @@ -911,7 +912,7 @@ func (sa *SockaddrIUCV) sockaddr() (unsafe.Pointer, _Socklen, error) { // These are EBCDIC encoded by the kernel, but we still need to pad them // with blanks. Initializing with blanks allows the caller to feed in either // a padded or an unpadded string. - for i := 0; i < 8; i++ { + for i := range 8 { sa.raw.Nodeid[i] = ' ' sa.raw.User_id[i] = ' ' sa.raw.Name[i] = ' ' @@ -1148,7 +1149,7 @@ func anyToSockaddr(fd int, rsa *RawSockaddrAny) (Sockaddr, error) { var user [8]byte var name [8]byte - for i := 0; i < 8; i++ { + for i := range 8 { user[i] = byte(pp.User_id[i]) name[i] = byte(pp.Name[i]) } @@ -1173,11 +1174,11 @@ func anyToSockaddr(fd int, rsa *RawSockaddrAny) (Sockaddr, error) { Ifindex: int(pp.Ifindex), } name := (*[8]byte)(unsafe.Pointer(&sa.Name)) - for i := 0; i < 8; i++ { + for i := range 8 { name[i] = pp.Addr[i] } pgn := (*[4]byte)(unsafe.Pointer(&sa.PGN)) - for i := 0; i < 4; i++ { + for i := range 4 { pgn[i] = pp.Addr[i+8] } addr := (*[1]byte)(unsafe.Pointer(&sa.Addr)) @@ -1188,11 +1189,11 @@ func anyToSockaddr(fd int, rsa *RawSockaddrAny) (Sockaddr, error) { Ifindex: int(pp.Ifindex), } rx := (*[4]byte)(unsafe.Pointer(&sa.RxID)) - for i := 0; i < 4; i++ { + for i := range 4 { rx[i] = pp.Addr[i] } tx := (*[4]byte)(unsafe.Pointer(&sa.TxID)) - for i := 0; i < 4; i++ { + for i := range 4 { tx[i] = pp.Addr[i+4] } return sa, nil @@ -2216,10 +2217,7 @@ func readvRacedetect(iovecs []Iovec, n int, err error) { return } for i := 0; n > 0 && i < len(iovecs); i++ { - m := int(iovecs[i].Len) - if m > n { - m = n - } + m := min(int(iovecs[i].Len), n) n -= m if m > 0 { raceWriteRange(unsafe.Pointer(iovecs[i].Base), m) @@ -2270,10 +2268,7 @@ func writevRacedetect(iovecs []Iovec, n int) { return } for i := 0; n > 0 && i < len(iovecs); i++ { - m := int(iovecs[i].Len) - if m > n { - m = n - } + m := min(int(iovecs[i].Len), n) n -= m if m > 0 { raceReadRange(unsafe.Pointer(iovecs[i].Base), m) @@ -2320,12 +2315,7 @@ func isGroupMember(gid int) bool { return false } - for _, g := range groups { - if g == gid { - return true - } - } - return false + return slices.Contains(groups, gid) } func isCapDacOverrideSet() bool { diff --git a/vendor/golang.org/x/sys/unix/zsyscall_darwin_amd64.go b/vendor/golang.org/x/sys/unix/zsyscall_darwin_amd64.go index 24b346e1a35..813c05b6647 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_darwin_amd64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_darwin_amd64.go @@ -2512,6 +2512,90 @@ var libc_munmap_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func readv(fd int, iovecs []Iovec) (n int, err error) { + var _p0 unsafe.Pointer + if len(iovecs) > 0 { + _p0 = unsafe.Pointer(&iovecs[0]) + } else { + _p0 = unsafe.Pointer(&_zero) + } + r0, _, e1 := syscall_syscall(libc_readv_trampoline_addr, uintptr(fd), uintptr(_p0), uintptr(len(iovecs))) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_readv_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_readv readv "/usr/lib/libSystem.B.dylib" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func preadv(fd int, iovecs []Iovec, offset int64) (n int, err error) { + var _p0 unsafe.Pointer + if len(iovecs) > 0 { + _p0 = unsafe.Pointer(&iovecs[0]) + } else { + _p0 = unsafe.Pointer(&_zero) + } + r0, _, e1 := syscall_syscall6(libc_preadv_trampoline_addr, uintptr(fd), uintptr(_p0), uintptr(len(iovecs)), uintptr(offset), 0, 0) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_preadv_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_preadv preadv "/usr/lib/libSystem.B.dylib" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func writev(fd int, iovecs []Iovec) (n int, err error) { + var _p0 unsafe.Pointer + if len(iovecs) > 0 { + _p0 = unsafe.Pointer(&iovecs[0]) + } else { + _p0 = unsafe.Pointer(&_zero) + } + r0, _, e1 := syscall_syscall(libc_writev_trampoline_addr, uintptr(fd), uintptr(_p0), uintptr(len(iovecs))) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_writev_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_writev writev "/usr/lib/libSystem.B.dylib" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func pwritev(fd int, iovecs []Iovec, offset int64) (n int, err error) { + var _p0 unsafe.Pointer + if len(iovecs) > 0 { + _p0 = unsafe.Pointer(&iovecs[0]) + } else { + _p0 = unsafe.Pointer(&_zero) + } + r0, _, e1 := syscall_syscall6(libc_pwritev_trampoline_addr, uintptr(fd), uintptr(_p0), uintptr(len(iovecs)), uintptr(offset), 0, 0) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_pwritev_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_pwritev pwritev "/usr/lib/libSystem.B.dylib" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func Fstat(fd int, stat *Stat_t) (err error) { _, _, e1 := syscall_syscall(libc_fstat64_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(stat)), 0) if e1 != 0 { diff --git a/vendor/golang.org/x/sys/unix/zsyscall_darwin_amd64.s b/vendor/golang.org/x/sys/unix/zsyscall_darwin_amd64.s index ebd213100b3..fda328582b2 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_darwin_amd64.s +++ b/vendor/golang.org/x/sys/unix/zsyscall_darwin_amd64.s @@ -738,6 +738,26 @@ TEXT libc_munmap_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_munmap_trampoline_addr(SB), RODATA, $8 DATA ·libc_munmap_trampoline_addr(SB)/8, $libc_munmap_trampoline<>(SB) +TEXT libc_readv_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_readv(SB) +GLOBL ·libc_readv_trampoline_addr(SB), RODATA, $8 +DATA ·libc_readv_trampoline_addr(SB)/8, $libc_readv_trampoline<>(SB) + +TEXT libc_preadv_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_preadv(SB) +GLOBL ·libc_preadv_trampoline_addr(SB), RODATA, $8 +DATA ·libc_preadv_trampoline_addr(SB)/8, $libc_preadv_trampoline<>(SB) + +TEXT libc_writev_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_writev(SB) +GLOBL ·libc_writev_trampoline_addr(SB), RODATA, $8 +DATA ·libc_writev_trampoline_addr(SB)/8, $libc_writev_trampoline<>(SB) + +TEXT libc_pwritev_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_pwritev(SB) +GLOBL ·libc_pwritev_trampoline_addr(SB), RODATA, $8 +DATA ·libc_pwritev_trampoline_addr(SB)/8, $libc_pwritev_trampoline<>(SB) + TEXT libc_fstat64_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fstat64(SB) GLOBL ·libc_fstat64_trampoline_addr(SB), RODATA, $8 diff --git a/vendor/golang.org/x/sys/unix/zsyscall_darwin_arm64.go b/vendor/golang.org/x/sys/unix/zsyscall_darwin_arm64.go index 824b9c2d5e0..e6f58f3c6f4 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_darwin_arm64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_darwin_arm64.go @@ -2512,6 +2512,90 @@ var libc_munmap_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func readv(fd int, iovecs []Iovec) (n int, err error) { + var _p0 unsafe.Pointer + if len(iovecs) > 0 { + _p0 = unsafe.Pointer(&iovecs[0]) + } else { + _p0 = unsafe.Pointer(&_zero) + } + r0, _, e1 := syscall_syscall(libc_readv_trampoline_addr, uintptr(fd), uintptr(_p0), uintptr(len(iovecs))) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_readv_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_readv readv "/usr/lib/libSystem.B.dylib" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func preadv(fd int, iovecs []Iovec, offset int64) (n int, err error) { + var _p0 unsafe.Pointer + if len(iovecs) > 0 { + _p0 = unsafe.Pointer(&iovecs[0]) + } else { + _p0 = unsafe.Pointer(&_zero) + } + r0, _, e1 := syscall_syscall6(libc_preadv_trampoline_addr, uintptr(fd), uintptr(_p0), uintptr(len(iovecs)), uintptr(offset), 0, 0) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_preadv_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_preadv preadv "/usr/lib/libSystem.B.dylib" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func writev(fd int, iovecs []Iovec) (n int, err error) { + var _p0 unsafe.Pointer + if len(iovecs) > 0 { + _p0 = unsafe.Pointer(&iovecs[0]) + } else { + _p0 = unsafe.Pointer(&_zero) + } + r0, _, e1 := syscall_syscall(libc_writev_trampoline_addr, uintptr(fd), uintptr(_p0), uintptr(len(iovecs))) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_writev_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_writev writev "/usr/lib/libSystem.B.dylib" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func pwritev(fd int, iovecs []Iovec, offset int64) (n int, err error) { + var _p0 unsafe.Pointer + if len(iovecs) > 0 { + _p0 = unsafe.Pointer(&iovecs[0]) + } else { + _p0 = unsafe.Pointer(&_zero) + } + r0, _, e1 := syscall_syscall6(libc_pwritev_trampoline_addr, uintptr(fd), uintptr(_p0), uintptr(len(iovecs)), uintptr(offset), 0, 0) + n = int(r0) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +var libc_pwritev_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_pwritev pwritev "/usr/lib/libSystem.B.dylib" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func Fstat(fd int, stat *Stat_t) (err error) { _, _, e1 := syscall_syscall(libc_fstat_trampoline_addr, uintptr(fd), uintptr(unsafe.Pointer(stat)), 0) if e1 != 0 { diff --git a/vendor/golang.org/x/sys/unix/zsyscall_darwin_arm64.s b/vendor/golang.org/x/sys/unix/zsyscall_darwin_arm64.s index 4f178a22934..7f8998b905b 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_darwin_arm64.s +++ b/vendor/golang.org/x/sys/unix/zsyscall_darwin_arm64.s @@ -738,6 +738,26 @@ TEXT libc_munmap_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_munmap_trampoline_addr(SB), RODATA, $8 DATA ·libc_munmap_trampoline_addr(SB)/8, $libc_munmap_trampoline<>(SB) +TEXT libc_readv_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_readv(SB) +GLOBL ·libc_readv_trampoline_addr(SB), RODATA, $8 +DATA ·libc_readv_trampoline_addr(SB)/8, $libc_readv_trampoline<>(SB) + +TEXT libc_preadv_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_preadv(SB) +GLOBL ·libc_preadv_trampoline_addr(SB), RODATA, $8 +DATA ·libc_preadv_trampoline_addr(SB)/8, $libc_preadv_trampoline<>(SB) + +TEXT libc_writev_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_writev(SB) +GLOBL ·libc_writev_trampoline_addr(SB), RODATA, $8 +DATA ·libc_writev_trampoline_addr(SB)/8, $libc_writev_trampoline<>(SB) + +TEXT libc_pwritev_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_pwritev(SB) +GLOBL ·libc_pwritev_trampoline_addr(SB), RODATA, $8 +DATA ·libc_pwritev_trampoline_addr(SB)/8, $libc_pwritev_trampoline<>(SB) + TEXT libc_fstat_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_fstat(SB) GLOBL ·libc_fstat_trampoline_addr(SB), RODATA, $8 diff --git a/vendor/golang.org/x/sys/windows/registry/key.go b/vendor/golang.org/x/sys/windows/registry/key.go index fd8632444ec..39aeeb644f5 100644 --- a/vendor/golang.org/x/sys/windows/registry/key.go +++ b/vendor/golang.org/x/sys/windows/registry/key.go @@ -164,7 +164,12 @@ loopItems: func CreateKey(k Key, path string, access uint32) (newk Key, openedExisting bool, err error) { var h syscall.Handle var d uint32 - err = regCreateKeyEx(syscall.Handle(k), syscall.StringToUTF16Ptr(path), + var pathPointer *uint16 + pathPointer, err = syscall.UTF16PtrFromString(path) + if err != nil { + return 0, false, err + } + err = regCreateKeyEx(syscall.Handle(k), pathPointer, 0, nil, _REG_OPTION_NON_VOLATILE, access, nil, &h, &d) if err != nil { return 0, false, err @@ -174,7 +179,11 @@ func CreateKey(k Key, path string, access uint32) (newk Key, openedExisting bool // DeleteKey deletes the subkey path of key k and its values. func DeleteKey(k Key, path string) error { - return regDeleteKey(syscall.Handle(k), syscall.StringToUTF16Ptr(path)) + pathPointer, err := syscall.UTF16PtrFromString(path) + if err != nil { + return err + } + return regDeleteKey(syscall.Handle(k), pathPointer) } // A KeyInfo describes the statistics of a key. It is returned by Stat. diff --git a/vendor/golang.org/x/sys/windows/registry/value.go b/vendor/golang.org/x/sys/windows/registry/value.go index 74db26b94df..a1bcbb2362c 100644 --- a/vendor/golang.org/x/sys/windows/registry/value.go +++ b/vendor/golang.org/x/sys/windows/registry/value.go @@ -340,7 +340,11 @@ func (k Key) SetBinaryValue(name string, value []byte) error { // DeleteValue removes a named value from the key k. func (k Key) DeleteValue(name string) error { - return regDeleteValue(syscall.Handle(k), syscall.StringToUTF16Ptr(name)) + namePointer, err := syscall.UTF16PtrFromString(name) + if err != nil { + return err + } + return regDeleteValue(syscall.Handle(k), namePointer) } // ReadValueNames returns the value names of key k. diff --git a/vendor/golang.org/x/sys/windows/types_windows.go b/vendor/golang.org/x/sys/windows/types_windows.go index 9d138de5fed..ad67df2fdb6 100644 --- a/vendor/golang.org/x/sys/windows/types_windows.go +++ b/vendor/golang.org/x/sys/windows/types_windows.go @@ -1074,6 +1074,7 @@ const ( IP_ADD_MEMBERSHIP = 0xc IP_DROP_MEMBERSHIP = 0xd IP_PKTINFO = 0x13 + IP_MTU_DISCOVER = 0x47 IPV6_V6ONLY = 0x1b IPV6_UNICAST_HOPS = 0x4 @@ -1083,6 +1084,7 @@ const ( IPV6_JOIN_GROUP = 0xc IPV6_LEAVE_GROUP = 0xd IPV6_PKTINFO = 0x13 + IPV6_MTU_DISCOVER = 0x47 MSG_OOB = 0x1 MSG_PEEK = 0x2 @@ -1132,6 +1134,15 @@ const ( WSASYS_STATUS_LEN = 128 ) +// enum PMTUD_STATE from ws2ipdef.h +const ( + IP_PMTUDISC_NOT_SET = 0 + IP_PMTUDISC_DO = 1 + IP_PMTUDISC_DONT = 2 + IP_PMTUDISC_PROBE = 3 + IP_PMTUDISC_MAX = 4 +) + type WSABuf struct { Len uint32 Buf *byte @@ -1146,6 +1157,22 @@ type WSAMsg struct { Flags uint32 } +type WSACMSGHDR struct { + Len uintptr + Level int32 + Type int32 +} + +type IN_PKTINFO struct { + Addr [4]byte + Ifindex uint32 +} + +type IN6_PKTINFO struct { + Addr [16]byte + Ifindex uint32 +} + // Flags for WSASocket const ( WSA_FLAG_OVERLAPPED = 0x01 diff --git a/vendor/golang.org/x/time/rate/rate.go b/vendor/golang.org/x/time/rate/rate.go index 93a798ab637..794b2e32bfa 100644 --- a/vendor/golang.org/x/time/rate/rate.go +++ b/vendor/golang.org/x/time/rate/rate.go @@ -85,7 +85,7 @@ func (lim *Limiter) Burst() int { // TokensAt returns the number of tokens available at time t. func (lim *Limiter) TokensAt(t time.Time) float64 { lim.mu.Lock() - _, tokens := lim.advance(t) // does not mutate lim + tokens := lim.advance(t) // does not mutate lim lim.mu.Unlock() return tokens } @@ -186,7 +186,7 @@ func (r *Reservation) CancelAt(t time.Time) { return } // advance time to now - t, tokens := r.lim.advance(t) + tokens := r.lim.advance(t) // calculate new number of tokens tokens += restoreTokens if burst := float64(r.lim.burst); tokens > burst { @@ -307,7 +307,7 @@ func (lim *Limiter) SetLimitAt(t time.Time, newLimit Limit) { lim.mu.Lock() defer lim.mu.Unlock() - t, tokens := lim.advance(t) + tokens := lim.advance(t) lim.last = t lim.tokens = tokens @@ -324,7 +324,7 @@ func (lim *Limiter) SetBurstAt(t time.Time, newBurst int) { lim.mu.Lock() defer lim.mu.Unlock() - t, tokens := lim.advance(t) + tokens := lim.advance(t) lim.last = t lim.tokens = tokens @@ -347,7 +347,7 @@ func (lim *Limiter) reserveN(t time.Time, n int, maxFutureReserve time.Duration) } } - t, tokens := lim.advance(t) + tokens := lim.advance(t) // Calculate the remaining number of tokens resulting from the request. tokens -= float64(n) @@ -380,10 +380,11 @@ func (lim *Limiter) reserveN(t time.Time, n int, maxFutureReserve time.Duration) return r } -// advance calculates and returns an updated state for lim resulting from the passage of time. +// advance calculates and returns an updated number of tokens for lim +// resulting from the passage of time. // lim is not changed. // advance requires that lim.mu is held. -func (lim *Limiter) advance(t time.Time) (newT time.Time, newTokens float64) { +func (lim *Limiter) advance(t time.Time) (newTokens float64) { last := lim.last if t.Before(last) { last = t @@ -396,7 +397,7 @@ func (lim *Limiter) advance(t time.Time) (newT time.Time, newTokens float64) { if burst := float64(lim.burst); tokens > burst { tokens = burst } - return t, tokens + return tokens } // durationFromTokens is a unit conversion function from the number of tokens to the duration @@ -405,8 +406,15 @@ func (limit Limit) durationFromTokens(tokens float64) time.Duration { if limit <= 0 { return InfDuration } - seconds := tokens / float64(limit) - return time.Duration(float64(time.Second) * seconds) + + duration := (tokens / float64(limit)) * float64(time.Second) + + // Cap the duration to the maximum representable int64 value, to avoid overflow. + if duration > float64(math.MaxInt64) { + return InfDuration + } + + return time.Duration(duration) } // tokensFromDuration is a unit conversion function from a time duration to the number of tokens diff --git a/vendor/google.golang.org/genproto/googleapis/api/annotations/client.pb.go b/vendor/google.golang.org/genproto/googleapis/api/annotations/client.pb.go index 4a9fce53c44..db7806cb994 100644 --- a/vendor/google.golang.org/genproto/googleapis/api/annotations/client.pb.go +++ b/vendor/google.golang.org/genproto/googleapis/api/annotations/client.pb.go @@ -1159,6 +1159,13 @@ type SelectiveGapicGeneration struct { // An allowlist of the fully qualified names of RPCs that should be included // on public client surfaces. Methods []string `protobuf:"bytes,1,rep,name=methods,proto3" json:"methods,omitempty"` + // Setting this to true indicates to the client generators that methods + // that would be excluded from the generation should instead be generated + // in a way that indicates these methods should not be consumed by + // end users. How this is expressed is up to individual language + // implementations to decide. Some examples may be: added annotations, + // obfuscated identifiers, or other language idiomatic patterns. + GenerateOmittedAsInternal bool `protobuf:"varint,2,opt,name=generate_omitted_as_internal,json=generateOmittedAsInternal,proto3" json:"generate_omitted_as_internal,omitempty"` } func (x *SelectiveGapicGeneration) Reset() { @@ -1200,6 +1207,13 @@ func (x *SelectiveGapicGeneration) GetMethods() []string { return nil } +func (x *SelectiveGapicGeneration) GetGenerateOmittedAsInternal() bool { + if x != nil { + return x.GenerateOmittedAsInternal + } + return false +} + // Experimental features to be included during client library generation. // These fields will be deprecated once the feature graduates and is enabled // by default. @@ -1218,6 +1232,11 @@ type PythonSettings_ExperimentalFeatures struct { // enabled by default 1 month after launching the feature in preview // packages. ProtobufPythonicTypesEnabled bool `protobuf:"varint,2,opt,name=protobuf_pythonic_types_enabled,json=protobufPythonicTypesEnabled,proto3" json:"protobuf_pythonic_types_enabled,omitempty"` + // Disables generation of an unversioned Python package for this client + // library. This means that the module names will need to be versioned in + // import statements. For example `import google.cloud.library_v2` instead + // of `import google.cloud.library`. + UnversionedPackageDisabled bool `protobuf:"varint,3,opt,name=unversioned_package_disabled,json=unversionedPackageDisabled,proto3" json:"unversioned_package_disabled,omitempty"` } func (x *PythonSettings_ExperimentalFeatures) Reset() { @@ -1266,6 +1285,13 @@ func (x *PythonSettings_ExperimentalFeatures) GetProtobufPythonicTypesEnabled() return false } +func (x *PythonSettings_ExperimentalFeatures) GetUnversionedPackageDisabled() bool { + if x != nil { + return x.UnversionedPackageDisabled + } + return false +} + // Describes settings to use when generating API methods that use the // long-running operation pattern. // All default values below are from those used in the client library @@ -1619,7 +1645,7 @@ var file_google_api_client_proto_rawDesc = []byte{ 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x22, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x43, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x4c, 0x61, 0x6e, 0x67, 0x75, 0x61, 0x67, 0x65, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x52, 0x06, 0x63, 0x6f, 0x6d, 0x6d, 0x6f, - 0x6e, 0x22, 0xc5, 0x02, 0x0a, 0x0e, 0x50, 0x79, 0x74, 0x68, 0x6f, 0x6e, 0x53, 0x65, 0x74, 0x74, + 0x6e, 0x22, 0x87, 0x03, 0x0a, 0x0e, 0x50, 0x79, 0x74, 0x68, 0x6f, 0x6e, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x12, 0x3a, 0x0a, 0x06, 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x22, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x43, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x4c, 0x61, 0x6e, 0x67, 0x75, 0x61, 0x67, 0x65, @@ -1630,7 +1656,7 @@ var file_google_api_client_proto_rawDesc = []byte{ 0x68, 0x6f, 0x6e, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x2e, 0x45, 0x78, 0x70, 0x65, 0x72, 0x69, 0x6d, 0x65, 0x6e, 0x74, 0x61, 0x6c, 0x46, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x73, 0x52, 0x14, 0x65, 0x78, 0x70, 0x65, 0x72, 0x69, 0x6d, 0x65, 0x6e, 0x74, 0x61, 0x6c, 0x46, 0x65, - 0x61, 0x74, 0x75, 0x72, 0x65, 0x73, 0x1a, 0x90, 0x01, 0x0a, 0x14, 0x45, 0x78, 0x70, 0x65, 0x72, + 0x61, 0x74, 0x75, 0x72, 0x65, 0x73, 0x1a, 0xd2, 0x01, 0x0a, 0x14, 0x45, 0x78, 0x70, 0x65, 0x72, 0x69, 0x6d, 0x65, 0x6e, 0x74, 0x61, 0x6c, 0x46, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x73, 0x12, 0x31, 0x0a, 0x15, 0x72, 0x65, 0x73, 0x74, 0x5f, 0x61, 0x73, 0x79, 0x6e, 0x63, 0x5f, 0x69, 0x6f, 0x5f, 0x65, 0x6e, 0x61, 0x62, 0x6c, 0x65, 0x64, 0x18, 0x01, 0x20, 0x01, 0x28, 0x08, 0x52, 0x12, @@ -1639,140 +1665,148 @@ var file_google_api_client_proto_rawDesc = []byte{ 0x79, 0x74, 0x68, 0x6f, 0x6e, 0x69, 0x63, 0x5f, 0x74, 0x79, 0x70, 0x65, 0x73, 0x5f, 0x65, 0x6e, 0x61, 0x62, 0x6c, 0x65, 0x64, 0x18, 0x02, 0x20, 0x01, 0x28, 0x08, 0x52, 0x1c, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x50, 0x79, 0x74, 0x68, 0x6f, 0x6e, 0x69, 0x63, 0x54, 0x79, 0x70, - 0x65, 0x73, 0x45, 0x6e, 0x61, 0x62, 0x6c, 0x65, 0x64, 0x22, 0x4a, 0x0a, 0x0c, 0x4e, 0x6f, 0x64, - 0x65, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x12, 0x3a, 0x0a, 0x06, 0x63, 0x6f, 0x6d, - 0x6d, 0x6f, 0x6e, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x22, 0x2e, 0x67, 0x6f, 0x6f, 0x67, - 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x43, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x4c, 0x61, 0x6e, - 0x67, 0x75, 0x61, 0x67, 0x65, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x52, 0x06, 0x63, - 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x22, 0xae, 0x04, 0x0a, 0x0e, 0x44, 0x6f, 0x74, 0x6e, 0x65, 0x74, + 0x65, 0x73, 0x45, 0x6e, 0x61, 0x62, 0x6c, 0x65, 0x64, 0x12, 0x40, 0x0a, 0x1c, 0x75, 0x6e, 0x76, + 0x65, 0x72, 0x73, 0x69, 0x6f, 0x6e, 0x65, 0x64, 0x5f, 0x70, 0x61, 0x63, 0x6b, 0x61, 0x67, 0x65, + 0x5f, 0x64, 0x69, 0x73, 0x61, 0x62, 0x6c, 0x65, 0x64, 0x18, 0x03, 0x20, 0x01, 0x28, 0x08, 0x52, + 0x1a, 0x75, 0x6e, 0x76, 0x65, 0x72, 0x73, 0x69, 0x6f, 0x6e, 0x65, 0x64, 0x50, 0x61, 0x63, 0x6b, + 0x61, 0x67, 0x65, 0x44, 0x69, 0x73, 0x61, 0x62, 0x6c, 0x65, 0x64, 0x22, 0x4a, 0x0a, 0x0c, 0x4e, + 0x6f, 0x64, 0x65, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x12, 0x3a, 0x0a, 0x06, 0x63, + 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x22, 0x2e, 0x67, 0x6f, + 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x43, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x4c, + 0x61, 0x6e, 0x67, 0x75, 0x61, 0x67, 0x65, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x52, + 0x06, 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x22, 0xae, 0x04, 0x0a, 0x0e, 0x44, 0x6f, 0x74, 0x6e, + 0x65, 0x74, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x12, 0x3a, 0x0a, 0x06, 0x63, 0x6f, + 0x6d, 0x6d, 0x6f, 0x6e, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x22, 0x2e, 0x67, 0x6f, 0x6f, + 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x43, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x4c, 0x61, + 0x6e, 0x67, 0x75, 0x61, 0x67, 0x65, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x52, 0x06, + 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x12, 0x5a, 0x0a, 0x10, 0x72, 0x65, 0x6e, 0x61, 0x6d, 0x65, + 0x64, 0x5f, 0x73, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x73, 0x18, 0x02, 0x20, 0x03, 0x28, 0x0b, + 0x32, 0x2f, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x44, 0x6f, + 0x74, 0x6e, 0x65, 0x74, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x2e, 0x52, 0x65, 0x6e, + 0x61, 0x6d, 0x65, 0x64, 0x53, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x73, 0x45, 0x6e, 0x74, 0x72, + 0x79, 0x52, 0x0f, 0x72, 0x65, 0x6e, 0x61, 0x6d, 0x65, 0x64, 0x53, 0x65, 0x72, 0x76, 0x69, 0x63, + 0x65, 0x73, 0x12, 0x5d, 0x0a, 0x11, 0x72, 0x65, 0x6e, 0x61, 0x6d, 0x65, 0x64, 0x5f, 0x72, 0x65, + 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x73, 0x18, 0x03, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x30, 0x2e, + 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x44, 0x6f, 0x74, 0x6e, 0x65, + 0x74, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x2e, 0x52, 0x65, 0x6e, 0x61, 0x6d, 0x65, + 0x64, 0x52, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x73, 0x45, 0x6e, 0x74, 0x72, 0x79, 0x52, + 0x10, 0x72, 0x65, 0x6e, 0x61, 0x6d, 0x65, 0x64, 0x52, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, + 0x73, 0x12, 0x2b, 0x0a, 0x11, 0x69, 0x67, 0x6e, 0x6f, 0x72, 0x65, 0x64, 0x5f, 0x72, 0x65, 0x73, + 0x6f, 0x75, 0x72, 0x63, 0x65, 0x73, 0x18, 0x04, 0x20, 0x03, 0x28, 0x09, 0x52, 0x10, 0x69, 0x67, + 0x6e, 0x6f, 0x72, 0x65, 0x64, 0x52, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x73, 0x12, 0x38, + 0x0a, 0x18, 0x66, 0x6f, 0x72, 0x63, 0x65, 0x64, 0x5f, 0x6e, 0x61, 0x6d, 0x65, 0x73, 0x70, 0x61, + 0x63, 0x65, 0x5f, 0x61, 0x6c, 0x69, 0x61, 0x73, 0x65, 0x73, 0x18, 0x05, 0x20, 0x03, 0x28, 0x09, + 0x52, 0x16, 0x66, 0x6f, 0x72, 0x63, 0x65, 0x64, 0x4e, 0x61, 0x6d, 0x65, 0x73, 0x70, 0x61, 0x63, + 0x65, 0x41, 0x6c, 0x69, 0x61, 0x73, 0x65, 0x73, 0x12, 0x35, 0x0a, 0x16, 0x68, 0x61, 0x6e, 0x64, + 0x77, 0x72, 0x69, 0x74, 0x74, 0x65, 0x6e, 0x5f, 0x73, 0x69, 0x67, 0x6e, 0x61, 0x74, 0x75, 0x72, + 0x65, 0x73, 0x18, 0x06, 0x20, 0x03, 0x28, 0x09, 0x52, 0x15, 0x68, 0x61, 0x6e, 0x64, 0x77, 0x72, + 0x69, 0x74, 0x74, 0x65, 0x6e, 0x53, 0x69, 0x67, 0x6e, 0x61, 0x74, 0x75, 0x72, 0x65, 0x73, 0x1a, + 0x42, 0x0a, 0x14, 0x52, 0x65, 0x6e, 0x61, 0x6d, 0x65, 0x64, 0x53, 0x65, 0x72, 0x76, 0x69, 0x63, + 0x65, 0x73, 0x45, 0x6e, 0x74, 0x72, 0x79, 0x12, 0x10, 0x0a, 0x03, 0x6b, 0x65, 0x79, 0x18, 0x01, + 0x20, 0x01, 0x28, 0x09, 0x52, 0x03, 0x6b, 0x65, 0x79, 0x12, 0x14, 0x0a, 0x05, 0x76, 0x61, 0x6c, + 0x75, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x3a, + 0x02, 0x38, 0x01, 0x1a, 0x43, 0x0a, 0x15, 0x52, 0x65, 0x6e, 0x61, 0x6d, 0x65, 0x64, 0x52, 0x65, + 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x73, 0x45, 0x6e, 0x74, 0x72, 0x79, 0x12, 0x10, 0x0a, 0x03, + 0x6b, 0x65, 0x79, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x03, 0x6b, 0x65, 0x79, 0x12, 0x14, + 0x0a, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x05, 0x76, + 0x61, 0x6c, 0x75, 0x65, 0x3a, 0x02, 0x38, 0x01, 0x22, 0x4a, 0x0a, 0x0c, 0x52, 0x75, 0x62, 0x79, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x12, 0x3a, 0x0a, 0x06, 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x22, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x43, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x4c, 0x61, 0x6e, 0x67, 0x75, 0x61, 0x67, 0x65, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x52, 0x06, 0x63, 0x6f, - 0x6d, 0x6d, 0x6f, 0x6e, 0x12, 0x5a, 0x0a, 0x10, 0x72, 0x65, 0x6e, 0x61, 0x6d, 0x65, 0x64, 0x5f, - 0x73, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x73, 0x18, 0x02, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x2f, - 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x44, 0x6f, 0x74, 0x6e, - 0x65, 0x74, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x2e, 0x52, 0x65, 0x6e, 0x61, 0x6d, - 0x65, 0x64, 0x53, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x73, 0x45, 0x6e, 0x74, 0x72, 0x79, 0x52, - 0x0f, 0x72, 0x65, 0x6e, 0x61, 0x6d, 0x65, 0x64, 0x53, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x73, - 0x12, 0x5d, 0x0a, 0x11, 0x72, 0x65, 0x6e, 0x61, 0x6d, 0x65, 0x64, 0x5f, 0x72, 0x65, 0x73, 0x6f, - 0x75, 0x72, 0x63, 0x65, 0x73, 0x18, 0x03, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x30, 0x2e, 0x67, 0x6f, - 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x44, 0x6f, 0x74, 0x6e, 0x65, 0x74, 0x53, - 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x2e, 0x52, 0x65, 0x6e, 0x61, 0x6d, 0x65, 0x64, 0x52, - 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x73, 0x45, 0x6e, 0x74, 0x72, 0x79, 0x52, 0x10, 0x72, - 0x65, 0x6e, 0x61, 0x6d, 0x65, 0x64, 0x52, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x73, 0x12, - 0x2b, 0x0a, 0x11, 0x69, 0x67, 0x6e, 0x6f, 0x72, 0x65, 0x64, 0x5f, 0x72, 0x65, 0x73, 0x6f, 0x75, - 0x72, 0x63, 0x65, 0x73, 0x18, 0x04, 0x20, 0x03, 0x28, 0x09, 0x52, 0x10, 0x69, 0x67, 0x6e, 0x6f, - 0x72, 0x65, 0x64, 0x52, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x73, 0x12, 0x38, 0x0a, 0x18, - 0x66, 0x6f, 0x72, 0x63, 0x65, 0x64, 0x5f, 0x6e, 0x61, 0x6d, 0x65, 0x73, 0x70, 0x61, 0x63, 0x65, - 0x5f, 0x61, 0x6c, 0x69, 0x61, 0x73, 0x65, 0x73, 0x18, 0x05, 0x20, 0x03, 0x28, 0x09, 0x52, 0x16, - 0x66, 0x6f, 0x72, 0x63, 0x65, 0x64, 0x4e, 0x61, 0x6d, 0x65, 0x73, 0x70, 0x61, 0x63, 0x65, 0x41, - 0x6c, 0x69, 0x61, 0x73, 0x65, 0x73, 0x12, 0x35, 0x0a, 0x16, 0x68, 0x61, 0x6e, 0x64, 0x77, 0x72, - 0x69, 0x74, 0x74, 0x65, 0x6e, 0x5f, 0x73, 0x69, 0x67, 0x6e, 0x61, 0x74, 0x75, 0x72, 0x65, 0x73, - 0x18, 0x06, 0x20, 0x03, 0x28, 0x09, 0x52, 0x15, 0x68, 0x61, 0x6e, 0x64, 0x77, 0x72, 0x69, 0x74, - 0x74, 0x65, 0x6e, 0x53, 0x69, 0x67, 0x6e, 0x61, 0x74, 0x75, 0x72, 0x65, 0x73, 0x1a, 0x42, 0x0a, - 0x14, 0x52, 0x65, 0x6e, 0x61, 0x6d, 0x65, 0x64, 0x53, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x73, - 0x45, 0x6e, 0x74, 0x72, 0x79, 0x12, 0x10, 0x0a, 0x03, 0x6b, 0x65, 0x79, 0x18, 0x01, 0x20, 0x01, - 0x28, 0x09, 0x52, 0x03, 0x6b, 0x65, 0x79, 0x12, 0x14, 0x0a, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, - 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x3a, 0x02, 0x38, - 0x01, 0x1a, 0x43, 0x0a, 0x15, 0x52, 0x65, 0x6e, 0x61, 0x6d, 0x65, 0x64, 0x52, 0x65, 0x73, 0x6f, - 0x75, 0x72, 0x63, 0x65, 0x73, 0x45, 0x6e, 0x74, 0x72, 0x79, 0x12, 0x10, 0x0a, 0x03, 0x6b, 0x65, - 0x79, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x03, 0x6b, 0x65, 0x79, 0x12, 0x14, 0x0a, 0x05, - 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x05, 0x76, 0x61, 0x6c, - 0x75, 0x65, 0x3a, 0x02, 0x38, 0x01, 0x22, 0x4a, 0x0a, 0x0c, 0x52, 0x75, 0x62, 0x79, 0x53, 0x65, - 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x12, 0x3a, 0x0a, 0x06, 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, - 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x22, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, - 0x61, 0x70, 0x69, 0x2e, 0x43, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x4c, 0x61, 0x6e, 0x67, 0x75, 0x61, - 0x67, 0x65, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x52, 0x06, 0x63, 0x6f, 0x6d, 0x6d, - 0x6f, 0x6e, 0x22, 0xe4, 0x01, 0x0a, 0x0a, 0x47, 0x6f, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, - 0x73, 0x12, 0x3a, 0x0a, 0x06, 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x18, 0x01, 0x20, 0x01, 0x28, - 0x0b, 0x32, 0x22, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x43, - 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x4c, 0x61, 0x6e, 0x67, 0x75, 0x61, 0x67, 0x65, 0x53, 0x65, 0x74, - 0x74, 0x69, 0x6e, 0x67, 0x73, 0x52, 0x06, 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x12, 0x56, 0x0a, - 0x10, 0x72, 0x65, 0x6e, 0x61, 0x6d, 0x65, 0x64, 0x5f, 0x73, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, - 0x73, 0x18, 0x02, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x2b, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, - 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x47, 0x6f, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x2e, - 0x52, 0x65, 0x6e, 0x61, 0x6d, 0x65, 0x64, 0x53, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x73, 0x45, - 0x6e, 0x74, 0x72, 0x79, 0x52, 0x0f, 0x72, 0x65, 0x6e, 0x61, 0x6d, 0x65, 0x64, 0x53, 0x65, 0x72, - 0x76, 0x69, 0x63, 0x65, 0x73, 0x1a, 0x42, 0x0a, 0x14, 0x52, 0x65, 0x6e, 0x61, 0x6d, 0x65, 0x64, - 0x53, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x73, 0x45, 0x6e, 0x74, 0x72, 0x79, 0x12, 0x10, 0x0a, - 0x03, 0x6b, 0x65, 0x79, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x03, 0x6b, 0x65, 0x79, 0x12, - 0x14, 0x0a, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x05, - 0x76, 0x61, 0x6c, 0x75, 0x65, 0x3a, 0x02, 0x38, 0x01, 0x22, 0xc2, 0x03, 0x0a, 0x0e, 0x4d, 0x65, - 0x74, 0x68, 0x6f, 0x64, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x12, 0x1a, 0x0a, 0x08, - 0x73, 0x65, 0x6c, 0x65, 0x63, 0x74, 0x6f, 0x72, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x08, - 0x73, 0x65, 0x6c, 0x65, 0x63, 0x74, 0x6f, 0x72, 0x12, 0x49, 0x0a, 0x0c, 0x6c, 0x6f, 0x6e, 0x67, - 0x5f, 0x72, 0x75, 0x6e, 0x6e, 0x69, 0x6e, 0x67, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x26, - 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x4d, 0x65, 0x74, 0x68, - 0x6f, 0x64, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x2e, 0x4c, 0x6f, 0x6e, 0x67, 0x52, - 0x75, 0x6e, 0x6e, 0x69, 0x6e, 0x67, 0x52, 0x0b, 0x6c, 0x6f, 0x6e, 0x67, 0x52, 0x75, 0x6e, 0x6e, - 0x69, 0x6e, 0x67, 0x12, 0x32, 0x0a, 0x15, 0x61, 0x75, 0x74, 0x6f, 0x5f, 0x70, 0x6f, 0x70, 0x75, - 0x6c, 0x61, 0x74, 0x65, 0x64, 0x5f, 0x66, 0x69, 0x65, 0x6c, 0x64, 0x73, 0x18, 0x03, 0x20, 0x03, - 0x28, 0x09, 0x52, 0x13, 0x61, 0x75, 0x74, 0x6f, 0x50, 0x6f, 0x70, 0x75, 0x6c, 0x61, 0x74, 0x65, - 0x64, 0x46, 0x69, 0x65, 0x6c, 0x64, 0x73, 0x1a, 0x94, 0x02, 0x0a, 0x0b, 0x4c, 0x6f, 0x6e, 0x67, - 0x52, 0x75, 0x6e, 0x6e, 0x69, 0x6e, 0x67, 0x12, 0x47, 0x0a, 0x12, 0x69, 0x6e, 0x69, 0x74, 0x69, - 0x61, 0x6c, 0x5f, 0x70, 0x6f, 0x6c, 0x6c, 0x5f, 0x64, 0x65, 0x6c, 0x61, 0x79, 0x18, 0x01, 0x20, + 0x6d, 0x6d, 0x6f, 0x6e, 0x22, 0xe4, 0x01, 0x0a, 0x0a, 0x47, 0x6f, 0x53, 0x65, 0x74, 0x74, 0x69, + 0x6e, 0x67, 0x73, 0x12, 0x3a, 0x0a, 0x06, 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x18, 0x01, 0x20, + 0x01, 0x28, 0x0b, 0x32, 0x22, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, + 0x2e, 0x43, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x4c, 0x61, 0x6e, 0x67, 0x75, 0x61, 0x67, 0x65, 0x53, + 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x52, 0x06, 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x12, + 0x56, 0x0a, 0x10, 0x72, 0x65, 0x6e, 0x61, 0x6d, 0x65, 0x64, 0x5f, 0x73, 0x65, 0x72, 0x76, 0x69, + 0x63, 0x65, 0x73, 0x18, 0x02, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x2b, 0x2e, 0x67, 0x6f, 0x6f, 0x67, + 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x47, 0x6f, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, + 0x73, 0x2e, 0x52, 0x65, 0x6e, 0x61, 0x6d, 0x65, 0x64, 0x53, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, + 0x73, 0x45, 0x6e, 0x74, 0x72, 0x79, 0x52, 0x0f, 0x72, 0x65, 0x6e, 0x61, 0x6d, 0x65, 0x64, 0x53, + 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x73, 0x1a, 0x42, 0x0a, 0x14, 0x52, 0x65, 0x6e, 0x61, 0x6d, + 0x65, 0x64, 0x53, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x73, 0x45, 0x6e, 0x74, 0x72, 0x79, 0x12, + 0x10, 0x0a, 0x03, 0x6b, 0x65, 0x79, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x03, 0x6b, 0x65, + 0x79, 0x12, 0x14, 0x0a, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, + 0x52, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x3a, 0x02, 0x38, 0x01, 0x22, 0xc2, 0x03, 0x0a, 0x0e, + 0x4d, 0x65, 0x74, 0x68, 0x6f, 0x64, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x12, 0x1a, + 0x0a, 0x08, 0x73, 0x65, 0x6c, 0x65, 0x63, 0x74, 0x6f, 0x72, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, + 0x52, 0x08, 0x73, 0x65, 0x6c, 0x65, 0x63, 0x74, 0x6f, 0x72, 0x12, 0x49, 0x0a, 0x0c, 0x6c, 0x6f, + 0x6e, 0x67, 0x5f, 0x72, 0x75, 0x6e, 0x6e, 0x69, 0x6e, 0x67, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, + 0x32, 0x26, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x4d, 0x65, + 0x74, 0x68, 0x6f, 0x64, 0x53, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x2e, 0x4c, 0x6f, 0x6e, + 0x67, 0x52, 0x75, 0x6e, 0x6e, 0x69, 0x6e, 0x67, 0x52, 0x0b, 0x6c, 0x6f, 0x6e, 0x67, 0x52, 0x75, + 0x6e, 0x6e, 0x69, 0x6e, 0x67, 0x12, 0x32, 0x0a, 0x15, 0x61, 0x75, 0x74, 0x6f, 0x5f, 0x70, 0x6f, + 0x70, 0x75, 0x6c, 0x61, 0x74, 0x65, 0x64, 0x5f, 0x66, 0x69, 0x65, 0x6c, 0x64, 0x73, 0x18, 0x03, + 0x20, 0x03, 0x28, 0x09, 0x52, 0x13, 0x61, 0x75, 0x74, 0x6f, 0x50, 0x6f, 0x70, 0x75, 0x6c, 0x61, + 0x74, 0x65, 0x64, 0x46, 0x69, 0x65, 0x6c, 0x64, 0x73, 0x1a, 0x94, 0x02, 0x0a, 0x0b, 0x4c, 0x6f, + 0x6e, 0x67, 0x52, 0x75, 0x6e, 0x6e, 0x69, 0x6e, 0x67, 0x12, 0x47, 0x0a, 0x12, 0x69, 0x6e, 0x69, + 0x74, 0x69, 0x61, 0x6c, 0x5f, 0x70, 0x6f, 0x6c, 0x6c, 0x5f, 0x64, 0x65, 0x6c, 0x61, 0x79, 0x18, + 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x19, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, + 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x44, 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, + 0x52, 0x10, 0x69, 0x6e, 0x69, 0x74, 0x69, 0x61, 0x6c, 0x50, 0x6f, 0x6c, 0x6c, 0x44, 0x65, 0x6c, + 0x61, 0x79, 0x12, 0x32, 0x0a, 0x15, 0x70, 0x6f, 0x6c, 0x6c, 0x5f, 0x64, 0x65, 0x6c, 0x61, 0x79, + 0x5f, 0x6d, 0x75, 0x6c, 0x74, 0x69, 0x70, 0x6c, 0x69, 0x65, 0x72, 0x18, 0x02, 0x20, 0x01, 0x28, + 0x02, 0x52, 0x13, 0x70, 0x6f, 0x6c, 0x6c, 0x44, 0x65, 0x6c, 0x61, 0x79, 0x4d, 0x75, 0x6c, 0x74, + 0x69, 0x70, 0x6c, 0x69, 0x65, 0x72, 0x12, 0x3f, 0x0a, 0x0e, 0x6d, 0x61, 0x78, 0x5f, 0x70, 0x6f, + 0x6c, 0x6c, 0x5f, 0x64, 0x65, 0x6c, 0x61, 0x79, 0x18, 0x03, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x19, + 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, + 0x2e, 0x44, 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x0c, 0x6d, 0x61, 0x78, 0x50, 0x6f, + 0x6c, 0x6c, 0x44, 0x65, 0x6c, 0x61, 0x79, 0x12, 0x47, 0x0a, 0x12, 0x74, 0x6f, 0x74, 0x61, 0x6c, + 0x5f, 0x70, 0x6f, 0x6c, 0x6c, 0x5f, 0x74, 0x69, 0x6d, 0x65, 0x6f, 0x75, 0x74, 0x18, 0x04, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x19, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x44, 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x10, - 0x69, 0x6e, 0x69, 0x74, 0x69, 0x61, 0x6c, 0x50, 0x6f, 0x6c, 0x6c, 0x44, 0x65, 0x6c, 0x61, 0x79, - 0x12, 0x32, 0x0a, 0x15, 0x70, 0x6f, 0x6c, 0x6c, 0x5f, 0x64, 0x65, 0x6c, 0x61, 0x79, 0x5f, 0x6d, - 0x75, 0x6c, 0x74, 0x69, 0x70, 0x6c, 0x69, 0x65, 0x72, 0x18, 0x02, 0x20, 0x01, 0x28, 0x02, 0x52, - 0x13, 0x70, 0x6f, 0x6c, 0x6c, 0x44, 0x65, 0x6c, 0x61, 0x79, 0x4d, 0x75, 0x6c, 0x74, 0x69, 0x70, - 0x6c, 0x69, 0x65, 0x72, 0x12, 0x3f, 0x0a, 0x0e, 0x6d, 0x61, 0x78, 0x5f, 0x70, 0x6f, 0x6c, 0x6c, - 0x5f, 0x64, 0x65, 0x6c, 0x61, 0x79, 0x18, 0x03, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x19, 0x2e, 0x67, - 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x44, - 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x0c, 0x6d, 0x61, 0x78, 0x50, 0x6f, 0x6c, 0x6c, - 0x44, 0x65, 0x6c, 0x61, 0x79, 0x12, 0x47, 0x0a, 0x12, 0x74, 0x6f, 0x74, 0x61, 0x6c, 0x5f, 0x70, - 0x6f, 0x6c, 0x6c, 0x5f, 0x74, 0x69, 0x6d, 0x65, 0x6f, 0x75, 0x74, 0x18, 0x04, 0x20, 0x01, 0x28, - 0x0b, 0x32, 0x19, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, - 0x62, 0x75, 0x66, 0x2e, 0x44, 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x10, 0x74, 0x6f, - 0x74, 0x61, 0x6c, 0x50, 0x6f, 0x6c, 0x6c, 0x54, 0x69, 0x6d, 0x65, 0x6f, 0x75, 0x74, 0x22, 0x34, - 0x0a, 0x18, 0x53, 0x65, 0x6c, 0x65, 0x63, 0x74, 0x69, 0x76, 0x65, 0x47, 0x61, 0x70, 0x69, 0x63, - 0x47, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x18, 0x0a, 0x07, 0x6d, 0x65, - 0x74, 0x68, 0x6f, 0x64, 0x73, 0x18, 0x01, 0x20, 0x03, 0x28, 0x09, 0x52, 0x07, 0x6d, 0x65, 0x74, - 0x68, 0x6f, 0x64, 0x73, 0x2a, 0xa3, 0x01, 0x0a, 0x19, 0x43, 0x6c, 0x69, 0x65, 0x6e, 0x74, 0x4c, - 0x69, 0x62, 0x72, 0x61, 0x72, 0x79, 0x4f, 0x72, 0x67, 0x61, 0x6e, 0x69, 0x7a, 0x61, 0x74, 0x69, - 0x6f, 0x6e, 0x12, 0x2b, 0x0a, 0x27, 0x43, 0x4c, 0x49, 0x45, 0x4e, 0x54, 0x5f, 0x4c, 0x49, 0x42, - 0x52, 0x41, 0x52, 0x59, 0x5f, 0x4f, 0x52, 0x47, 0x41, 0x4e, 0x49, 0x5a, 0x41, 0x54, 0x49, 0x4f, - 0x4e, 0x5f, 0x55, 0x4e, 0x53, 0x50, 0x45, 0x43, 0x49, 0x46, 0x49, 0x45, 0x44, 0x10, 0x00, 0x12, - 0x09, 0x0a, 0x05, 0x43, 0x4c, 0x4f, 0x55, 0x44, 0x10, 0x01, 0x12, 0x07, 0x0a, 0x03, 0x41, 0x44, - 0x53, 0x10, 0x02, 0x12, 0x0a, 0x0a, 0x06, 0x50, 0x48, 0x4f, 0x54, 0x4f, 0x53, 0x10, 0x03, 0x12, - 0x0f, 0x0a, 0x0b, 0x53, 0x54, 0x52, 0x45, 0x45, 0x54, 0x5f, 0x56, 0x49, 0x45, 0x57, 0x10, 0x04, - 0x12, 0x0c, 0x0a, 0x08, 0x53, 0x48, 0x4f, 0x50, 0x50, 0x49, 0x4e, 0x47, 0x10, 0x05, 0x12, 0x07, - 0x0a, 0x03, 0x47, 0x45, 0x4f, 0x10, 0x06, 0x12, 0x11, 0x0a, 0x0d, 0x47, 0x45, 0x4e, 0x45, 0x52, - 0x41, 0x54, 0x49, 0x56, 0x45, 0x5f, 0x41, 0x49, 0x10, 0x07, 0x2a, 0x67, 0x0a, 0x18, 0x43, 0x6c, - 0x69, 0x65, 0x6e, 0x74, 0x4c, 0x69, 0x62, 0x72, 0x61, 0x72, 0x79, 0x44, 0x65, 0x73, 0x74, 0x69, - 0x6e, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x2a, 0x0a, 0x26, 0x43, 0x4c, 0x49, 0x45, 0x4e, 0x54, - 0x5f, 0x4c, 0x49, 0x42, 0x52, 0x41, 0x52, 0x59, 0x5f, 0x44, 0x45, 0x53, 0x54, 0x49, 0x4e, 0x41, + 0x74, 0x6f, 0x74, 0x61, 0x6c, 0x50, 0x6f, 0x6c, 0x6c, 0x54, 0x69, 0x6d, 0x65, 0x6f, 0x75, 0x74, + 0x22, 0x75, 0x0a, 0x18, 0x53, 0x65, 0x6c, 0x65, 0x63, 0x74, 0x69, 0x76, 0x65, 0x47, 0x61, 0x70, + 0x69, 0x63, 0x47, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x18, 0x0a, 0x07, + 0x6d, 0x65, 0x74, 0x68, 0x6f, 0x64, 0x73, 0x18, 0x01, 0x20, 0x03, 0x28, 0x09, 0x52, 0x07, 0x6d, + 0x65, 0x74, 0x68, 0x6f, 0x64, 0x73, 0x12, 0x3f, 0x0a, 0x1c, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, + 0x74, 0x65, 0x5f, 0x6f, 0x6d, 0x69, 0x74, 0x74, 0x65, 0x64, 0x5f, 0x61, 0x73, 0x5f, 0x69, 0x6e, + 0x74, 0x65, 0x72, 0x6e, 0x61, 0x6c, 0x18, 0x02, 0x20, 0x01, 0x28, 0x08, 0x52, 0x19, 0x67, 0x65, + 0x6e, 0x65, 0x72, 0x61, 0x74, 0x65, 0x4f, 0x6d, 0x69, 0x74, 0x74, 0x65, 0x64, 0x41, 0x73, 0x49, + 0x6e, 0x74, 0x65, 0x72, 0x6e, 0x61, 0x6c, 0x2a, 0xa3, 0x01, 0x0a, 0x19, 0x43, 0x6c, 0x69, 0x65, + 0x6e, 0x74, 0x4c, 0x69, 0x62, 0x72, 0x61, 0x72, 0x79, 0x4f, 0x72, 0x67, 0x61, 0x6e, 0x69, 0x7a, + 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x2b, 0x0a, 0x27, 0x43, 0x4c, 0x49, 0x45, 0x4e, 0x54, 0x5f, + 0x4c, 0x49, 0x42, 0x52, 0x41, 0x52, 0x59, 0x5f, 0x4f, 0x52, 0x47, 0x41, 0x4e, 0x49, 0x5a, 0x41, 0x54, 0x49, 0x4f, 0x4e, 0x5f, 0x55, 0x4e, 0x53, 0x50, 0x45, 0x43, 0x49, 0x46, 0x49, 0x45, 0x44, - 0x10, 0x00, 0x12, 0x0a, 0x0a, 0x06, 0x47, 0x49, 0x54, 0x48, 0x55, 0x42, 0x10, 0x0a, 0x12, 0x13, - 0x0a, 0x0f, 0x50, 0x41, 0x43, 0x4b, 0x41, 0x47, 0x45, 0x5f, 0x4d, 0x41, 0x4e, 0x41, 0x47, 0x45, - 0x52, 0x10, 0x14, 0x3a, 0x4a, 0x0a, 0x10, 0x6d, 0x65, 0x74, 0x68, 0x6f, 0x64, 0x5f, 0x73, 0x69, - 0x67, 0x6e, 0x61, 0x74, 0x75, 0x72, 0x65, 0x12, 0x1e, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, - 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x4d, 0x65, 0x74, 0x68, 0x6f, 0x64, - 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x18, 0x9b, 0x08, 0x20, 0x03, 0x28, 0x09, 0x52, 0x0f, - 0x6d, 0x65, 0x74, 0x68, 0x6f, 0x64, 0x53, 0x69, 0x67, 0x6e, 0x61, 0x74, 0x75, 0x72, 0x65, 0x3a, - 0x43, 0x0a, 0x0c, 0x64, 0x65, 0x66, 0x61, 0x75, 0x6c, 0x74, 0x5f, 0x68, 0x6f, 0x73, 0x74, 0x12, - 0x1f, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, - 0x66, 0x2e, 0x53, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, - 0x18, 0x99, 0x08, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0b, 0x64, 0x65, 0x66, 0x61, 0x75, 0x6c, 0x74, - 0x48, 0x6f, 0x73, 0x74, 0x3a, 0x43, 0x0a, 0x0c, 0x6f, 0x61, 0x75, 0x74, 0x68, 0x5f, 0x73, 0x63, - 0x6f, 0x70, 0x65, 0x73, 0x12, 0x1f, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, - 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x53, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x4f, 0x70, - 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x18, 0x9a, 0x08, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0b, 0x6f, 0x61, - 0x75, 0x74, 0x68, 0x53, 0x63, 0x6f, 0x70, 0x65, 0x73, 0x3a, 0x44, 0x0a, 0x0b, 0x61, 0x70, 0x69, - 0x5f, 0x76, 0x65, 0x72, 0x73, 0x69, 0x6f, 0x6e, 0x12, 0x1f, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, - 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x53, 0x65, 0x72, 0x76, 0x69, - 0x63, 0x65, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x18, 0xc1, 0xba, 0xab, 0xfa, 0x01, 0x20, - 0x01, 0x28, 0x09, 0x52, 0x0a, 0x61, 0x70, 0x69, 0x56, 0x65, 0x72, 0x73, 0x69, 0x6f, 0x6e, 0x42, - 0x69, 0x0a, 0x0e, 0x63, 0x6f, 0x6d, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, - 0x69, 0x42, 0x0b, 0x43, 0x6c, 0x69, 0x65, 0x6e, 0x74, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x50, 0x01, - 0x5a, 0x41, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x67, 0x6f, 0x6c, 0x61, 0x6e, 0x67, 0x2e, - 0x6f, 0x72, 0x67, 0x2f, 0x67, 0x65, 0x6e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x2f, 0x67, 0x6f, 0x6f, - 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2f, 0x61, 0x70, 0x69, 0x2f, 0x61, 0x6e, 0x6e, 0x6f, - 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x3b, 0x61, 0x6e, 0x6e, 0x6f, 0x74, 0x61, 0x74, 0x69, - 0x6f, 0x6e, 0x73, 0xa2, 0x02, 0x04, 0x47, 0x41, 0x50, 0x49, 0x62, 0x06, 0x70, 0x72, 0x6f, 0x74, - 0x6f, 0x33, + 0x10, 0x00, 0x12, 0x09, 0x0a, 0x05, 0x43, 0x4c, 0x4f, 0x55, 0x44, 0x10, 0x01, 0x12, 0x07, 0x0a, + 0x03, 0x41, 0x44, 0x53, 0x10, 0x02, 0x12, 0x0a, 0x0a, 0x06, 0x50, 0x48, 0x4f, 0x54, 0x4f, 0x53, + 0x10, 0x03, 0x12, 0x0f, 0x0a, 0x0b, 0x53, 0x54, 0x52, 0x45, 0x45, 0x54, 0x5f, 0x56, 0x49, 0x45, + 0x57, 0x10, 0x04, 0x12, 0x0c, 0x0a, 0x08, 0x53, 0x48, 0x4f, 0x50, 0x50, 0x49, 0x4e, 0x47, 0x10, + 0x05, 0x12, 0x07, 0x0a, 0x03, 0x47, 0x45, 0x4f, 0x10, 0x06, 0x12, 0x11, 0x0a, 0x0d, 0x47, 0x45, + 0x4e, 0x45, 0x52, 0x41, 0x54, 0x49, 0x56, 0x45, 0x5f, 0x41, 0x49, 0x10, 0x07, 0x2a, 0x67, 0x0a, + 0x18, 0x43, 0x6c, 0x69, 0x65, 0x6e, 0x74, 0x4c, 0x69, 0x62, 0x72, 0x61, 0x72, 0x79, 0x44, 0x65, + 0x73, 0x74, 0x69, 0x6e, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x2a, 0x0a, 0x26, 0x43, 0x4c, 0x49, + 0x45, 0x4e, 0x54, 0x5f, 0x4c, 0x49, 0x42, 0x52, 0x41, 0x52, 0x59, 0x5f, 0x44, 0x45, 0x53, 0x54, + 0x49, 0x4e, 0x41, 0x54, 0x49, 0x4f, 0x4e, 0x5f, 0x55, 0x4e, 0x53, 0x50, 0x45, 0x43, 0x49, 0x46, + 0x49, 0x45, 0x44, 0x10, 0x00, 0x12, 0x0a, 0x0a, 0x06, 0x47, 0x49, 0x54, 0x48, 0x55, 0x42, 0x10, + 0x0a, 0x12, 0x13, 0x0a, 0x0f, 0x50, 0x41, 0x43, 0x4b, 0x41, 0x47, 0x45, 0x5f, 0x4d, 0x41, 0x4e, + 0x41, 0x47, 0x45, 0x52, 0x10, 0x14, 0x3a, 0x4a, 0x0a, 0x10, 0x6d, 0x65, 0x74, 0x68, 0x6f, 0x64, + 0x5f, 0x73, 0x69, 0x67, 0x6e, 0x61, 0x74, 0x75, 0x72, 0x65, 0x12, 0x1e, 0x2e, 0x67, 0x6f, 0x6f, + 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x4d, 0x65, 0x74, + 0x68, 0x6f, 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x18, 0x9b, 0x08, 0x20, 0x03, 0x28, + 0x09, 0x52, 0x0f, 0x6d, 0x65, 0x74, 0x68, 0x6f, 0x64, 0x53, 0x69, 0x67, 0x6e, 0x61, 0x74, 0x75, + 0x72, 0x65, 0x3a, 0x43, 0x0a, 0x0c, 0x64, 0x65, 0x66, 0x61, 0x75, 0x6c, 0x74, 0x5f, 0x68, 0x6f, + 0x73, 0x74, 0x12, 0x1f, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, + 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x53, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x4f, 0x70, 0x74, 0x69, + 0x6f, 0x6e, 0x73, 0x18, 0x99, 0x08, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0b, 0x64, 0x65, 0x66, 0x61, + 0x75, 0x6c, 0x74, 0x48, 0x6f, 0x73, 0x74, 0x3a, 0x43, 0x0a, 0x0c, 0x6f, 0x61, 0x75, 0x74, 0x68, + 0x5f, 0x73, 0x63, 0x6f, 0x70, 0x65, 0x73, 0x12, 0x1f, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, + 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x53, 0x65, 0x72, 0x76, 0x69, 0x63, + 0x65, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x18, 0x9a, 0x08, 0x20, 0x01, 0x28, 0x09, 0x52, + 0x0b, 0x6f, 0x61, 0x75, 0x74, 0x68, 0x53, 0x63, 0x6f, 0x70, 0x65, 0x73, 0x3a, 0x44, 0x0a, 0x0b, + 0x61, 0x70, 0x69, 0x5f, 0x76, 0x65, 0x72, 0x73, 0x69, 0x6f, 0x6e, 0x12, 0x1f, 0x2e, 0x67, 0x6f, + 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x53, 0x65, + 0x72, 0x76, 0x69, 0x63, 0x65, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x18, 0xc1, 0xba, 0xab, + 0xfa, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0a, 0x61, 0x70, 0x69, 0x56, 0x65, 0x72, 0x73, 0x69, + 0x6f, 0x6e, 0x42, 0x69, 0x0a, 0x0e, 0x63, 0x6f, 0x6d, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, + 0x2e, 0x61, 0x70, 0x69, 0x42, 0x0b, 0x43, 0x6c, 0x69, 0x65, 0x6e, 0x74, 0x50, 0x72, 0x6f, 0x74, + 0x6f, 0x50, 0x01, 0x5a, 0x41, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x67, 0x6f, 0x6c, 0x61, + 0x6e, 0x67, 0x2e, 0x6f, 0x72, 0x67, 0x2f, 0x67, 0x65, 0x6e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x2f, + 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2f, 0x61, 0x70, 0x69, 0x2f, 0x61, + 0x6e, 0x6e, 0x6f, 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x3b, 0x61, 0x6e, 0x6e, 0x6f, 0x74, + 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0xa2, 0x02, 0x04, 0x47, 0x41, 0x50, 0x49, 0x62, 0x06, 0x70, + 0x72, 0x6f, 0x74, 0x6f, 0x33, } var ( diff --git a/vendor/google.golang.org/genproto/googleapis/api/annotations/http.pb.go b/vendor/google.golang.org/genproto/googleapis/api/annotations/http.pb.go index ffb5838cb18..c93b4f52487 100644 --- a/vendor/google.golang.org/genproto/googleapis/api/annotations/http.pb.go +++ b/vendor/google.golang.org/genproto/googleapis/api/annotations/http.pb.go @@ -663,14 +663,14 @@ var file_google_api_http_proto_rawDesc = []byte{ 0x75, 0x73, 0x74, 0x6f, 0x6d, 0x48, 0x74, 0x74, 0x70, 0x50, 0x61, 0x74, 0x74, 0x65, 0x72, 0x6e, 0x12, 0x12, 0x0a, 0x04, 0x6b, 0x69, 0x6e, 0x64, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x04, 0x6b, 0x69, 0x6e, 0x64, 0x12, 0x12, 0x0a, 0x04, 0x70, 0x61, 0x74, 0x68, 0x18, 0x02, 0x20, 0x01, - 0x28, 0x09, 0x52, 0x04, 0x70, 0x61, 0x74, 0x68, 0x42, 0x6a, 0x0a, 0x0e, 0x63, 0x6f, 0x6d, 0x2e, + 0x28, 0x09, 0x52, 0x04, 0x70, 0x61, 0x74, 0x68, 0x42, 0x67, 0x0a, 0x0e, 0x63, 0x6f, 0x6d, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x42, 0x09, 0x48, 0x74, 0x74, 0x70, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x50, 0x01, 0x5a, 0x41, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x67, 0x6f, 0x6c, 0x61, 0x6e, 0x67, 0x2e, 0x6f, 0x72, 0x67, 0x2f, 0x67, 0x65, 0x6e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x2f, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2f, 0x61, 0x70, 0x69, 0x2f, 0x61, 0x6e, 0x6e, 0x6f, 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x3b, 0x61, - 0x6e, 0x6e, 0x6f, 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0xf8, 0x01, 0x01, 0xa2, 0x02, 0x04, - 0x47, 0x41, 0x50, 0x49, 0x62, 0x06, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x33, + 0x6e, 0x6e, 0x6f, 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0xa2, 0x02, 0x04, 0x47, 0x41, 0x50, + 0x49, 0x62, 0x06, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x33, } var ( diff --git a/vendor/google.golang.org/genproto/googleapis/api/annotations/resource.pb.go b/vendor/google.golang.org/genproto/googleapis/api/annotations/resource.pb.go index b5db279aebf..a1c543a9487 100644 --- a/vendor/google.golang.org/genproto/googleapis/api/annotations/resource.pb.go +++ b/vendor/google.golang.org/genproto/googleapis/api/annotations/resource.pb.go @@ -556,15 +556,14 @@ var file_google_api_resource_proto_rawDesc = []byte{ 0x67, 0x65, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x18, 0x9d, 0x08, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1e, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x2e, 0x52, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, - 0x52, 0x08, 0x72, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x42, 0x6e, 0x0a, 0x0e, 0x63, 0x6f, + 0x52, 0x08, 0x72, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x42, 0x6b, 0x0a, 0x0e, 0x63, 0x6f, 0x6d, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x61, 0x70, 0x69, 0x42, 0x0d, 0x52, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x50, 0x01, 0x5a, 0x41, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x67, 0x6f, 0x6c, 0x61, 0x6e, 0x67, 0x2e, 0x6f, 0x72, 0x67, 0x2f, 0x67, 0x65, 0x6e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x2f, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x61, 0x70, 0x69, 0x73, 0x2f, 0x61, 0x70, 0x69, 0x2f, 0x61, 0x6e, 0x6e, 0x6f, 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x3b, 0x61, 0x6e, 0x6e, 0x6f, 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, - 0xf8, 0x01, 0x01, 0xa2, 0x02, 0x04, 0x47, 0x41, 0x50, 0x49, 0x62, 0x06, 0x70, 0x72, 0x6f, 0x74, - 0x6f, 0x33, + 0xa2, 0x02, 0x04, 0x47, 0x41, 0x50, 0x49, 0x62, 0x06, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x33, } var ( diff --git a/vendor/google.golang.org/genproto/googleapis/api/annotations/routing.pb.go b/vendor/google.golang.org/genproto/googleapis/api/annotations/routing.pb.go index 1d8397b02b4..2b54db30456 100644 --- a/vendor/google.golang.org/genproto/googleapis/api/annotations/routing.pb.go +++ b/vendor/google.golang.org/genproto/googleapis/api/annotations/routing.pb.go @@ -69,7 +69,7 @@ const ( // The routing header consists of one or multiple key-value pairs. Every key // and value must be percent-encoded, and joined together in the format of // `key1=value1&key2=value2`. -// In the examples below I am skipping the percent-encoding for readablity. +// The examples below skip the percent-encoding for readability. // // # Example 1 // diff --git a/vendor/google.golang.org/protobuf/encoding/protojson/decode.go b/vendor/google.golang.org/protobuf/encoding/protojson/decode.go index cffdfda9619..737d6876d5e 100644 --- a/vendor/google.golang.org/protobuf/encoding/protojson/decode.go +++ b/vendor/google.golang.org/protobuf/encoding/protojson/decode.go @@ -192,11 +192,6 @@ func (d decoder) unmarshalMessage(m protoreflect.Message, skipTypeURL bool) erro fd = fieldDescs.ByTextName(name) } } - if flags.ProtoLegacyWeak { - if fd != nil && fd.IsWeak() && fd.Message().IsPlaceholder() { - fd = nil // reset since the weak reference is not linked in - } - } if fd == nil { // Field is unknown. diff --git a/vendor/google.golang.org/protobuf/encoding/prototext/decode.go b/vendor/google.golang.org/protobuf/encoding/prototext/decode.go index d972a3d98ed..b53805056a9 100644 --- a/vendor/google.golang.org/protobuf/encoding/prototext/decode.go +++ b/vendor/google.golang.org/protobuf/encoding/prototext/decode.go @@ -185,11 +185,6 @@ func (d decoder) unmarshalMessage(m protoreflect.Message, checkDelims bool) erro } else if xtErr != nil && xtErr != protoregistry.NotFound { return d.newError(tok.Pos(), "unable to resolve [%s]: %v", tok.RawString(), xtErr) } - if flags.ProtoLegacyWeak { - if fd != nil && fd.IsWeak() && fd.Message().IsPlaceholder() { - fd = nil // reset since the weak reference is not linked in - } - } // Handle unknown fields. if fd == nil { diff --git a/vendor/google.golang.org/protobuf/internal/editiondefaults/editions_defaults.binpb b/vendor/google.golang.org/protobuf/internal/editiondefaults/editions_defaults.binpb index 5a57ef6f3c80a4a930b7bdb33b039ea94d1eb5f2..323829da1477e4496d664b2a1092a9f9cec275d4 100644 GIT binary patch literal 146 zcmX}mF%Ezr3X5(&e%rBRTLK{CjOa+)E@2mYkk=mEF7 B6)FG# literal 138 zcmd;*muO*EV!mX@pe4$|D8MAaq`<7fXux#Ijt$6VkYMDJmv|0Wz$CyZ!KlClRKN&Q wzyMY7f?Y`%s2WL*1th1%ddZFnY{E-+C6MVz3P75fB^b3pHY+@1*LcYe04AXnGXMYp diff --git a/vendor/google.golang.org/protobuf/internal/encoding/tag/tag.go b/vendor/google.golang.org/protobuf/internal/encoding/tag/tag.go index 7e87c760443..669133d04dc 100644 --- a/vendor/google.golang.org/protobuf/internal/encoding/tag/tag.go +++ b/vendor/google.golang.org/protobuf/internal/encoding/tag/tag.go @@ -26,7 +26,7 @@ var byteType = reflect.TypeOf(byte(0)) // The type is the underlying field type (e.g., a repeated field may be // represented by []T, but the Go type passed in is just T). // A list of enum value descriptors must be provided for enum fields. -// This does not populate the Enum or Message (except for weak message). +// This does not populate the Enum or Message. // // This function is a best effort attempt; parsing errors are ignored. func Unmarshal(tag string, goType reflect.Type, evs protoreflect.EnumValueDescriptors) protoreflect.FieldDescriptor { @@ -109,9 +109,6 @@ func Unmarshal(tag string, goType reflect.Type, evs protoreflect.EnumValueDescri } case s == "packed": f.L1.EditionFeatures.IsPacked = true - case strings.HasPrefix(s, "weak="): - f.L1.IsWeak = true - f.L1.Message = filedesc.PlaceholderMessage(protoreflect.FullName(s[len("weak="):])) case strings.HasPrefix(s, "def="): // The default tag is special in that everything afterwards is the // default regardless of the presence of commas. @@ -183,9 +180,6 @@ func Marshal(fd protoreflect.FieldDescriptor, enumName string) string { // the exact same semantics from the previous generator. tag = append(tag, "json="+jsonName) } - if fd.IsWeak() { - tag = append(tag, "weak="+string(fd.Message().FullName())) - } // The previous implementation does not tag extension fields as proto3, // even when the field is defined in a proto3 file. Match that behavior // for consistency. diff --git a/vendor/google.golang.org/protobuf/internal/filedesc/desc.go b/vendor/google.golang.org/protobuf/internal/filedesc/desc.go index 378b826faa6..688aabe434e 100644 --- a/vendor/google.golang.org/protobuf/internal/filedesc/desc.go +++ b/vendor/google.golang.org/protobuf/internal/filedesc/desc.go @@ -19,7 +19,6 @@ import ( "google.golang.org/protobuf/internal/pragma" "google.golang.org/protobuf/internal/strs" "google.golang.org/protobuf/reflect/protoreflect" - "google.golang.org/protobuf/reflect/protoregistry" ) // Edition is an Enum for proto2.Edition @@ -275,7 +274,6 @@ type ( Kind protoreflect.Kind StringName stringName IsProto3Optional bool // promoted from google.protobuf.FieldDescriptorProto - IsWeak bool // promoted from google.protobuf.FieldOptions IsLazy bool // promoted from google.protobuf.FieldOptions Default defaultValue ContainingOneof protoreflect.OneofDescriptor // must be consistent with Message.Oneofs.Fields @@ -369,7 +367,7 @@ func (fd *Field) IsPacked() bool { return fd.L1.EditionFeatures.IsPacked } func (fd *Field) IsExtension() bool { return false } -func (fd *Field) IsWeak() bool { return fd.L1.IsWeak } +func (fd *Field) IsWeak() bool { return false } func (fd *Field) IsLazy() bool { return fd.L1.IsLazy } func (fd *Field) IsList() bool { return fd.Cardinality() == protoreflect.Repeated && !fd.IsMap() } func (fd *Field) IsMap() bool { return fd.Message() != nil && fd.Message().IsMapEntry() } @@ -396,11 +394,6 @@ func (fd *Field) Enum() protoreflect.EnumDescriptor { return fd.L1.Enum } func (fd *Field) Message() protoreflect.MessageDescriptor { - if fd.L1.IsWeak { - if d, _ := protoregistry.GlobalFiles.FindDescriptorByName(fd.L1.Message.FullName()); d != nil { - return d.(protoreflect.MessageDescriptor) - } - } return fd.L1.Message } func (fd *Field) IsMapEntry() bool { diff --git a/vendor/google.golang.org/protobuf/internal/filedesc/desc_lazy.go b/vendor/google.golang.org/protobuf/internal/filedesc/desc_lazy.go index 67a51b327c5..d4c94458bd9 100644 --- a/vendor/google.golang.org/protobuf/internal/filedesc/desc_lazy.go +++ b/vendor/google.golang.org/protobuf/internal/filedesc/desc_lazy.go @@ -32,11 +32,6 @@ func (file *File) resolveMessages() { for j := range md.L2.Fields.List { fd := &md.L2.Fields.List[j] - // Weak fields are resolved upon actual use. - if fd.L1.IsWeak { - continue - } - // Resolve message field dependency. switch fd.L1.Kind { case protoreflect.EnumKind: @@ -150,8 +145,6 @@ func (fd *File) unmarshalFull(b []byte) { switch num { case genid.FileDescriptorProto_PublicDependency_field_number: fd.L2.Imports[v].IsPublic = true - case genid.FileDescriptorProto_WeakDependency_field_number: - fd.L2.Imports[v].IsWeak = true } case protowire.BytesType: v, m := protowire.ConsumeBytes(b) @@ -502,8 +495,6 @@ func (fd *Field) unmarshalOptions(b []byte) { switch num { case genid.FieldOptions_Packed_field_number: fd.L1.EditionFeatures.IsPacked = protowire.DecodeBool(v) - case genid.FieldOptions_Weak_field_number: - fd.L1.IsWeak = protowire.DecodeBool(v) case genid.FieldOptions_Lazy_field_number: fd.L1.IsLazy = protowire.DecodeBool(v) case FieldOptions_EnforceUTF8: diff --git a/vendor/google.golang.org/protobuf/internal/filedesc/editions.go b/vendor/google.golang.org/protobuf/internal/filedesc/editions.go index 10132c9b384..b08b71830c6 100644 --- a/vendor/google.golang.org/protobuf/internal/filedesc/editions.go +++ b/vendor/google.golang.org/protobuf/internal/filedesc/editions.go @@ -69,6 +69,9 @@ func unmarshalFeatureSet(b []byte, parent EditionFeatures) EditionFeatures { parent.IsDelimitedEncoded = v == genid.FeatureSet_DELIMITED_enum_value case genid.FeatureSet_JsonFormat_field_number: parent.IsJSONCompliant = v == genid.FeatureSet_ALLOW_enum_value + case genid.FeatureSet_EnforceNamingStyle_field_number: + // EnforceNamingStyle is enforced in protoc, languages other than C++ + // are not supposed to do anything with this feature. default: panic(fmt.Sprintf("unkown field number %d while unmarshalling FeatureSet", num)) } diff --git a/vendor/google.golang.org/protobuf/internal/filetype/build.go b/vendor/google.golang.org/protobuf/internal/filetype/build.go index ba83fea44c3..e1b4130bd28 100644 --- a/vendor/google.golang.org/protobuf/internal/filetype/build.go +++ b/vendor/google.golang.org/protobuf/internal/filetype/build.go @@ -63,7 +63,7 @@ type Builder struct { // message declarations in "flattened ordering". // // Dependencies are Go types for enums or messages referenced by - // message fields (excluding weak fields), for parent extended messages of + // message fields, for parent extended messages of // extension fields, for enums or messages referenced by extension fields, // and for input and output messages referenced by service methods. // Dependencies must come after declarations, but the ordering of diff --git a/vendor/google.golang.org/protobuf/internal/flags/flags.go b/vendor/google.golang.org/protobuf/internal/flags/flags.go index 5cb3ee70f91..a06ccabc2fa 100644 --- a/vendor/google.golang.org/protobuf/internal/flags/flags.go +++ b/vendor/google.golang.org/protobuf/internal/flags/flags.go @@ -6,7 +6,7 @@ package flags // ProtoLegacy specifies whether to enable support for legacy functionality -// such as MessageSets, weak fields, and various other obscure behavior +// such as MessageSets, and various other obscure behavior // that is necessary to maintain backwards compatibility with proto1 or // the pre-release variants of proto2 and proto3. // @@ -22,8 +22,3 @@ const ProtoLegacy = protoLegacy // extension fields at unmarshal time, but defers creating the message // structure until the extension is first accessed. const LazyUnmarshalExtensions = ProtoLegacy - -// ProtoLegacyWeak specifies whether to enable support for weak fields. -// This flag was split out of ProtoLegacy in preparation for removing -// support for weak fields (independent of the other protolegacy features). -const ProtoLegacyWeak = ProtoLegacy diff --git a/vendor/google.golang.org/protobuf/internal/genid/descriptor_gen.go b/vendor/google.golang.org/protobuf/internal/genid/descriptor_gen.go index f30ab6b586f..39524782add 100644 --- a/vendor/google.golang.org/protobuf/internal/genid/descriptor_gen.go +++ b/vendor/google.golang.org/protobuf/internal/genid/descriptor_gen.go @@ -1014,6 +1014,7 @@ const ( FeatureSet_Utf8Validation_field_name protoreflect.Name = "utf8_validation" FeatureSet_MessageEncoding_field_name protoreflect.Name = "message_encoding" FeatureSet_JsonFormat_field_name protoreflect.Name = "json_format" + FeatureSet_EnforceNamingStyle_field_name protoreflect.Name = "enforce_naming_style" FeatureSet_FieldPresence_field_fullname protoreflect.FullName = "google.protobuf.FeatureSet.field_presence" FeatureSet_EnumType_field_fullname protoreflect.FullName = "google.protobuf.FeatureSet.enum_type" @@ -1021,6 +1022,7 @@ const ( FeatureSet_Utf8Validation_field_fullname protoreflect.FullName = "google.protobuf.FeatureSet.utf8_validation" FeatureSet_MessageEncoding_field_fullname protoreflect.FullName = "google.protobuf.FeatureSet.message_encoding" FeatureSet_JsonFormat_field_fullname protoreflect.FullName = "google.protobuf.FeatureSet.json_format" + FeatureSet_EnforceNamingStyle_field_fullname protoreflect.FullName = "google.protobuf.FeatureSet.enforce_naming_style" ) // Field numbers for google.protobuf.FeatureSet. @@ -1031,6 +1033,7 @@ const ( FeatureSet_Utf8Validation_field_number protoreflect.FieldNumber = 4 FeatureSet_MessageEncoding_field_number protoreflect.FieldNumber = 5 FeatureSet_JsonFormat_field_number protoreflect.FieldNumber = 6 + FeatureSet_EnforceNamingStyle_field_number protoreflect.FieldNumber = 7 ) // Full and short names for google.protobuf.FeatureSet.FieldPresence. @@ -1112,6 +1115,19 @@ const ( FeatureSet_LEGACY_BEST_EFFORT_enum_value = 2 ) +// Full and short names for google.protobuf.FeatureSet.EnforceNamingStyle. +const ( + FeatureSet_EnforceNamingStyle_enum_fullname = "google.protobuf.FeatureSet.EnforceNamingStyle" + FeatureSet_EnforceNamingStyle_enum_name = "EnforceNamingStyle" +) + +// Enum values for google.protobuf.FeatureSet.EnforceNamingStyle. +const ( + FeatureSet_ENFORCE_NAMING_STYLE_UNKNOWN_enum_value = 0 + FeatureSet_STYLE2024_enum_value = 1 + FeatureSet_STYLE_LEGACY_enum_value = 2 +) + // Names for google.protobuf.FeatureSetDefaults. const ( FeatureSetDefaults_message_name protoreflect.Name = "FeatureSetDefaults" diff --git a/vendor/google.golang.org/protobuf/internal/genid/goname.go b/vendor/google.golang.org/protobuf/internal/genid/goname.go index 693d2e9e1fe..99bb95bafd5 100644 --- a/vendor/google.golang.org/protobuf/internal/genid/goname.go +++ b/vendor/google.golang.org/protobuf/internal/genid/goname.go @@ -11,15 +11,10 @@ const ( SizeCache_goname = "sizeCache" SizeCacheA_goname = "XXX_sizecache" - WeakFields_goname = "weakFields" - WeakFieldsA_goname = "XXX_weak" - UnknownFields_goname = "unknownFields" UnknownFieldsA_goname = "XXX_unrecognized" ExtensionFields_goname = "extensionFields" ExtensionFieldsA_goname = "XXX_InternalExtensions" ExtensionFieldsB_goname = "XXX_extensions" - - WeakFieldPrefix_goname = "XXX_weak_" ) diff --git a/vendor/google.golang.org/protobuf/internal/impl/codec_field.go b/vendor/google.golang.org/protobuf/internal/impl/codec_field.go index 7c1f66c8c19..d14d7d93cca 100644 --- a/vendor/google.golang.org/protobuf/internal/impl/codec_field.go +++ b/vendor/google.golang.org/protobuf/internal/impl/codec_field.go @@ -5,15 +5,12 @@ package impl import ( - "fmt" "reflect" - "sync" "google.golang.org/protobuf/encoding/protowire" "google.golang.org/protobuf/internal/errors" "google.golang.org/protobuf/proto" "google.golang.org/protobuf/reflect/protoreflect" - "google.golang.org/protobuf/reflect/protoregistry" "google.golang.org/protobuf/runtime/protoiface" ) @@ -121,78 +118,6 @@ func (mi *MessageInfo) initOneofFieldCoders(od protoreflect.OneofDescriptor, si } } -func makeWeakMessageFieldCoder(fd protoreflect.FieldDescriptor) pointerCoderFuncs { - var once sync.Once - var messageType protoreflect.MessageType - lazyInit := func() { - once.Do(func() { - messageName := fd.Message().FullName() - messageType, _ = protoregistry.GlobalTypes.FindMessageByName(messageName) - }) - } - - return pointerCoderFuncs{ - size: func(p pointer, f *coderFieldInfo, opts marshalOptions) int { - m, ok := p.WeakFields().get(f.num) - if !ok { - return 0 - } - lazyInit() - if messageType == nil { - panic(fmt.Sprintf("weak message %v is not linked in", fd.Message().FullName())) - } - return sizeMessage(m, f.tagsize, opts) - }, - marshal: func(b []byte, p pointer, f *coderFieldInfo, opts marshalOptions) ([]byte, error) { - m, ok := p.WeakFields().get(f.num) - if !ok { - return b, nil - } - lazyInit() - if messageType == nil { - panic(fmt.Sprintf("weak message %v is not linked in", fd.Message().FullName())) - } - return appendMessage(b, m, f.wiretag, opts) - }, - unmarshal: func(b []byte, p pointer, wtyp protowire.Type, f *coderFieldInfo, opts unmarshalOptions) (unmarshalOutput, error) { - fs := p.WeakFields() - m, ok := fs.get(f.num) - if !ok { - lazyInit() - if messageType == nil { - return unmarshalOutput{}, errUnknown - } - m = messageType.New().Interface() - fs.set(f.num, m) - } - return consumeMessage(b, m, wtyp, opts) - }, - isInit: func(p pointer, f *coderFieldInfo) error { - m, ok := p.WeakFields().get(f.num) - if !ok { - return nil - } - return proto.CheckInitialized(m) - }, - merge: func(dst, src pointer, f *coderFieldInfo, opts mergeOptions) { - sm, ok := src.WeakFields().get(f.num) - if !ok { - return - } - dm, ok := dst.WeakFields().get(f.num) - if !ok { - lazyInit() - if messageType == nil { - panic(fmt.Sprintf("weak message %v is not linked in", fd.Message().FullName())) - } - dm = messageType.New().Interface() - dst.WeakFields().set(f.num, dm) - } - opts.Merge(dm, sm) - }, - } -} - func makeMessageFieldCoder(fd protoreflect.FieldDescriptor, ft reflect.Type) pointerCoderFuncs { if mi := getMessageInfo(ft); mi != nil { funcs := pointerCoderFuncs{ diff --git a/vendor/google.golang.org/protobuf/internal/impl/codec_message.go b/vendor/google.golang.org/protobuf/internal/impl/codec_message.go index 111d95833d4..f78b57b0467 100644 --- a/vendor/google.golang.org/protobuf/internal/impl/codec_message.go +++ b/vendor/google.golang.org/protobuf/internal/impl/codec_message.go @@ -119,9 +119,6 @@ func (mi *MessageInfo) makeCoderMethods(t reflect.Type, si structInfo) { } case isOneof: fieldOffset = offsetOf(fs) - case fd.IsWeak(): - fieldOffset = si.weakOffset - funcs = makeWeakMessageFieldCoder(fd) default: fieldOffset = offsetOf(fs) childMessage, funcs = fieldCoder(fd, ft) diff --git a/vendor/google.golang.org/protobuf/internal/impl/codec_message_opaque.go b/vendor/google.golang.org/protobuf/internal/impl/codec_message_opaque.go index f81d7d0db9a..41c1f74ef81 100644 --- a/vendor/google.golang.org/protobuf/internal/impl/codec_message_opaque.go +++ b/vendor/google.golang.org/protobuf/internal/impl/codec_message_opaque.go @@ -46,9 +46,6 @@ func (mi *MessageInfo) makeOpaqueCoderMethods(t reflect.Type, si opaqueStructInf switch { case fd.ContainingOneof() != nil && !fd.ContainingOneof().IsSynthetic(): fieldOffset = offsetOf(fs) - case fd.IsWeak(): - fieldOffset = si.weakOffset - funcs = makeWeakMessageFieldCoder(fd) case fd.Message() != nil && !fd.IsMap(): fieldOffset = offsetOf(fs) if fd.IsList() { diff --git a/vendor/google.golang.org/protobuf/internal/impl/lazy.go b/vendor/google.golang.org/protobuf/internal/impl/lazy.go index e8fb6c35b4a..c7de31e243e 100644 --- a/vendor/google.golang.org/protobuf/internal/impl/lazy.go +++ b/vendor/google.golang.org/protobuf/internal/impl/lazy.go @@ -131,7 +131,7 @@ func (mi *MessageInfo) skipField(b []byte, f *coderFieldInfo, wtyp protowire.Typ fmi := f.validation.mi if fmi == nil { fd := mi.Desc.Fields().ByNumber(f.num) - if fd == nil || !fd.IsWeak() { + if fd == nil { return out, ValidationUnknown } messageName := fd.Message().FullName() diff --git a/vendor/google.golang.org/protobuf/internal/impl/legacy_message.go b/vendor/google.golang.org/protobuf/internal/impl/legacy_message.go index bf0b6049b46..a51dffbe294 100644 --- a/vendor/google.golang.org/protobuf/internal/impl/legacy_message.go +++ b/vendor/google.golang.org/protobuf/internal/impl/legacy_message.go @@ -310,12 +310,9 @@ func aberrantAppendField(md *filedesc.Message, goType reflect.Type, tag, tagKey, fd.L0.Parent = md fd.L0.Index = n - if fd.L1.IsWeak || fd.L1.EditionFeatures.IsPacked { + if fd.L1.EditionFeatures.IsPacked { fd.L1.Options = func() protoreflect.ProtoMessage { opts := descopts.Field.ProtoReflect().New() - if fd.L1.IsWeak { - opts.Set(opts.Descriptor().Fields().ByName("weak"), protoreflect.ValueOfBool(true)) - } if fd.L1.EditionFeatures.IsPacked { opts.Set(opts.Descriptor().Fields().ByName("packed"), protoreflect.ValueOfBool(fd.L1.EditionFeatures.IsPacked)) } diff --git a/vendor/google.golang.org/protobuf/internal/impl/message.go b/vendor/google.golang.org/protobuf/internal/impl/message.go index d1f79b4224f..d50423dcb77 100644 --- a/vendor/google.golang.org/protobuf/internal/impl/message.go +++ b/vendor/google.golang.org/protobuf/internal/impl/message.go @@ -14,7 +14,6 @@ import ( "google.golang.org/protobuf/internal/genid" "google.golang.org/protobuf/reflect/protoreflect" - "google.golang.org/protobuf/reflect/protoregistry" ) // MessageInfo provides protobuf related functionality for a given Go type @@ -120,7 +119,6 @@ type ( var ( sizecacheType = reflect.TypeOf(SizeCache(0)) - weakFieldsType = reflect.TypeOf(WeakFields(nil)) unknownFieldsAType = reflect.TypeOf(unknownFieldsA(nil)) unknownFieldsBType = reflect.TypeOf(unknownFieldsB(nil)) extensionFieldsType = reflect.TypeOf(ExtensionFields(nil)) @@ -129,8 +127,6 @@ var ( type structInfo struct { sizecacheOffset offset sizecacheType reflect.Type - weakOffset offset - weakType reflect.Type unknownOffset offset unknownType reflect.Type extensionOffset offset @@ -148,7 +144,6 @@ type structInfo struct { func (mi *MessageInfo) makeStructInfo(t reflect.Type) structInfo { si := structInfo{ sizecacheOffset: invalidOffset, - weakOffset: invalidOffset, unknownOffset: invalidOffset, extensionOffset: invalidOffset, lazyOffset: invalidOffset, @@ -168,11 +163,6 @@ fieldLoop: si.sizecacheOffset = offsetOf(f) si.sizecacheType = f.Type } - case genid.WeakFields_goname, genid.WeakFieldsA_goname: - if f.Type == weakFieldsType { - si.weakOffset = offsetOf(f) - si.weakType = f.Type - } case genid.UnknownFields_goname, genid.UnknownFieldsA_goname: if f.Type == unknownFieldsAType || f.Type == unknownFieldsBType { si.unknownOffset = offsetOf(f) @@ -256,9 +246,6 @@ func (mi *MessageInfo) Message(i int) protoreflect.MessageType { mi.init() fd := mi.Desc.Fields().Get(i) switch { - case fd.IsWeak(): - mt, _ := protoregistry.GlobalTypes.FindMessageByName(fd.Message().FullName()) - return mt case fd.IsMap(): return mapEntryType{fd.Message(), mi.fieldTypes[fd.Number()]} default: diff --git a/vendor/google.golang.org/protobuf/internal/impl/message_opaque.go b/vendor/google.golang.org/protobuf/internal/impl/message_opaque.go index d8dcd788636..dd55e8e009c 100644 --- a/vendor/google.golang.org/protobuf/internal/impl/message_opaque.go +++ b/vendor/google.golang.org/protobuf/internal/impl/message_opaque.go @@ -56,9 +56,6 @@ func opaqueInitHook(mi *MessageInfo) bool { usePresence, _ := usePresenceForField(si, fd) switch { - case fd.IsWeak(): - // Weak fields are no different for opaque. - fi = fieldInfoForWeakMessage(fd, si.weakOffset) case fd.ContainingOneof() != nil && !fd.ContainingOneof().IsSynthetic(): // Oneofs are no different for opaque. fi = fieldInfoForOneof(fd, si.oneofsByName[fd.ContainingOneof().Name()], mi.Exporter, si.oneofWrappersByNumber[fd.Number()]) @@ -620,8 +617,6 @@ func usePresenceForField(si opaqueStructInfo, fd protoreflect.FieldDescriptor) ( switch { case fd.ContainingOneof() != nil && !fd.ContainingOneof().IsSynthetic(): return false, false - case fd.IsWeak(): - return false, false case fd.IsMap(): return false, false case fd.Kind() == protoreflect.MessageKind || fd.Kind() == protoreflect.GroupKind: diff --git a/vendor/google.golang.org/protobuf/internal/impl/message_reflect.go b/vendor/google.golang.org/protobuf/internal/impl/message_reflect.go index 31c19b54f8d..0d20132fa24 100644 --- a/vendor/google.golang.org/protobuf/internal/impl/message_reflect.go +++ b/vendor/google.golang.org/protobuf/internal/impl/message_reflect.go @@ -72,8 +72,6 @@ func (mi *MessageInfo) makeKnownFieldsFunc(si structInfo) { fi = fieldInfoForMap(fd, fs, mi.Exporter) case fd.IsList(): fi = fieldInfoForList(fd, fs, mi.Exporter) - case fd.IsWeak(): - fi = fieldInfoForWeakMessage(fd, si.weakOffset) case fd.Message() != nil: fi = fieldInfoForMessage(fd, fs, mi.Exporter) default: @@ -219,9 +217,6 @@ func (mi *MessageInfo) makeFieldTypes(si structInfo) { } case fd.Message() != nil: ft = fs.Type - if fd.IsWeak() { - ft = nil - } isMessage = true } if isMessage && ft != nil && ft.Kind() != reflect.Ptr { diff --git a/vendor/google.golang.org/protobuf/internal/impl/message_reflect_field.go b/vendor/google.golang.org/protobuf/internal/impl/message_reflect_field.go index 3cd1fbc21fb..68d4ae32ec9 100644 --- a/vendor/google.golang.org/protobuf/internal/impl/message_reflect_field.go +++ b/vendor/google.golang.org/protobuf/internal/impl/message_reflect_field.go @@ -8,11 +8,8 @@ import ( "fmt" "math" "reflect" - "sync" - "google.golang.org/protobuf/internal/flags" "google.golang.org/protobuf/reflect/protoreflect" - "google.golang.org/protobuf/reflect/protoregistry" ) type fieldInfo struct { @@ -332,79 +329,6 @@ func fieldInfoForScalar(fd protoreflect.FieldDescriptor, fs reflect.StructField, } } -func fieldInfoForWeakMessage(fd protoreflect.FieldDescriptor, weakOffset offset) fieldInfo { - if !flags.ProtoLegacyWeak { - panic("no support for proto1 weak fields") - } - - var once sync.Once - var messageType protoreflect.MessageType - lazyInit := func() { - once.Do(func() { - messageName := fd.Message().FullName() - messageType, _ = protoregistry.GlobalTypes.FindMessageByName(messageName) - if messageType == nil { - panic(fmt.Sprintf("weak message %v for field %v is not linked in", messageName, fd.FullName())) - } - }) - } - - num := fd.Number() - return fieldInfo{ - fieldDesc: fd, - has: func(p pointer) bool { - if p.IsNil() { - return false - } - _, ok := p.Apply(weakOffset).WeakFields().get(num) - return ok - }, - clear: func(p pointer) { - p.Apply(weakOffset).WeakFields().clear(num) - }, - get: func(p pointer) protoreflect.Value { - lazyInit() - if p.IsNil() { - return protoreflect.ValueOfMessage(messageType.Zero()) - } - m, ok := p.Apply(weakOffset).WeakFields().get(num) - if !ok { - return protoreflect.ValueOfMessage(messageType.Zero()) - } - return protoreflect.ValueOfMessage(m.ProtoReflect()) - }, - set: func(p pointer, v protoreflect.Value) { - lazyInit() - m := v.Message() - if m.Descriptor() != messageType.Descriptor() { - if got, want := m.Descriptor().FullName(), messageType.Descriptor().FullName(); got != want { - panic(fmt.Sprintf("field %v has mismatching message descriptor: got %v, want %v", fd.FullName(), got, want)) - } - panic(fmt.Sprintf("field %v has mismatching message descriptor: %v", fd.FullName(), m.Descriptor().FullName())) - } - p.Apply(weakOffset).WeakFields().set(num, m.Interface()) - }, - mutable: func(p pointer) protoreflect.Value { - lazyInit() - fs := p.Apply(weakOffset).WeakFields() - m, ok := fs.get(num) - if !ok { - m = messageType.New().Interface() - fs.set(num, m) - } - return protoreflect.ValueOfMessage(m.ProtoReflect()) - }, - newMessage: func() protoreflect.Message { - lazyInit() - return messageType.New() - }, - newField: func() protoreflect.Value { - lazyInit() - return protoreflect.ValueOfMessage(messageType.New()) - }, - } -} - func fieldInfoForMessage(fd protoreflect.FieldDescriptor, fs reflect.StructField, x exporter) fieldInfo { ft := fs.Type conv := NewConverter(ft, fd) diff --git a/vendor/google.golang.org/protobuf/internal/impl/pointer_unsafe.go b/vendor/google.golang.org/protobuf/internal/impl/pointer_unsafe.go index 6bed45e35c2..62f8bf663ea 100644 --- a/vendor/google.golang.org/protobuf/internal/impl/pointer_unsafe.go +++ b/vendor/google.golang.org/protobuf/internal/impl/pointer_unsafe.go @@ -111,7 +111,6 @@ func (p pointer) StringSlice() *[]string { return (*[]string)(p.p func (p pointer) Bytes() *[]byte { return (*[]byte)(p.p) } func (p pointer) BytesPtr() **[]byte { return (**[]byte)(p.p) } func (p pointer) BytesSlice() *[][]byte { return (*[][]byte)(p.p) } -func (p pointer) WeakFields() *weakFields { return (*weakFields)(p.p) } func (p pointer) Extensions() *map[int32]ExtensionField { return (*map[int32]ExtensionField)(p.p) } func (p pointer) LazyInfoPtr() **protolazy.XXX_lazyUnmarshalInfo { return (**protolazy.XXX_lazyUnmarshalInfo)(p.p) diff --git a/vendor/google.golang.org/protobuf/internal/impl/validate.go b/vendor/google.golang.org/protobuf/internal/impl/validate.go index b534a3d6dbb..7b2995dde5e 100644 --- a/vendor/google.golang.org/protobuf/internal/impl/validate.go +++ b/vendor/google.golang.org/protobuf/internal/impl/validate.go @@ -211,9 +211,7 @@ func newValidationInfo(fd protoreflect.FieldDescriptor, ft reflect.Type) validat switch fd.Kind() { case protoreflect.MessageKind: vi.typ = validationTypeMessage - if !fd.IsWeak() { - vi.mi = getMessageInfo(ft) - } + vi.mi = getMessageInfo(ft) case protoreflect.GroupKind: vi.typ = validationTypeGroup vi.mi = getMessageInfo(ft) @@ -320,26 +318,6 @@ State: } if f != nil { vi = f.validation - if vi.typ == validationTypeMessage && vi.mi == nil { - // Probable weak field. - // - // TODO: Consider storing the results of this lookup somewhere - // rather than recomputing it on every validation. - fd := st.mi.Desc.Fields().ByNumber(num) - if fd == nil || !fd.IsWeak() { - break - } - messageName := fd.Message().FullName() - messageType, err := protoregistry.GlobalTypes.FindMessageByName(messageName) - switch err { - case nil: - vi.mi, _ = messageType.(*MessageInfo) - case protoregistry.NotFound: - vi.typ = validationTypeBytes - default: - return out, ValidationUnknown - } - } break } // Possible extension field. diff --git a/vendor/google.golang.org/protobuf/internal/impl/weak.go b/vendor/google.golang.org/protobuf/internal/impl/weak.go deleted file mode 100644 index eb79a7ba94c..00000000000 --- a/vendor/google.golang.org/protobuf/internal/impl/weak.go +++ /dev/null @@ -1,74 +0,0 @@ -// Copyright 2019 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package impl - -import ( - "fmt" - - "google.golang.org/protobuf/reflect/protoreflect" - "google.golang.org/protobuf/reflect/protoregistry" -) - -// weakFields adds methods to the exported WeakFields type for internal use. -// -// The exported type is an alias to an unnamed type, so methods can't be -// defined directly on it. -type weakFields WeakFields - -func (w weakFields) get(num protoreflect.FieldNumber) (protoreflect.ProtoMessage, bool) { - m, ok := w[int32(num)] - return m, ok -} - -func (w *weakFields) set(num protoreflect.FieldNumber, m protoreflect.ProtoMessage) { - if *w == nil { - *w = make(weakFields) - } - (*w)[int32(num)] = m -} - -func (w *weakFields) clear(num protoreflect.FieldNumber) { - delete(*w, int32(num)) -} - -func (Export) HasWeak(w WeakFields, num protoreflect.FieldNumber) bool { - _, ok := w[int32(num)] - return ok -} - -func (Export) ClearWeak(w *WeakFields, num protoreflect.FieldNumber) { - delete(*w, int32(num)) -} - -func (Export) GetWeak(w WeakFields, num protoreflect.FieldNumber, name protoreflect.FullName) protoreflect.ProtoMessage { - if m, ok := w[int32(num)]; ok { - return m - } - mt, _ := protoregistry.GlobalTypes.FindMessageByName(name) - if mt == nil { - panic(fmt.Sprintf("message %v for weak field is not linked in", name)) - } - return mt.Zero().Interface() -} - -func (Export) SetWeak(w *WeakFields, num protoreflect.FieldNumber, name protoreflect.FullName, m protoreflect.ProtoMessage) { - if m != nil { - mt, _ := protoregistry.GlobalTypes.FindMessageByName(name) - if mt == nil { - panic(fmt.Sprintf("message %v for weak field is not linked in", name)) - } - if mt != m.ProtoReflect().Type() { - panic(fmt.Sprintf("invalid message type for weak field: got %T, want %T", m, mt.Zero().Interface())) - } - } - if m == nil || !m.ProtoReflect().IsValid() { - delete(*w, int32(num)) - return - } - if *w == nil { - *w = make(weakFields) - } - (*w)[int32(num)] = m -} diff --git a/vendor/google.golang.org/protobuf/internal/strs/strings_unsafe_go121.go b/vendor/google.golang.org/protobuf/internal/strs/strings_unsafe.go similarity index 99% rename from vendor/google.golang.org/protobuf/internal/strs/strings_unsafe_go121.go rename to vendor/google.golang.org/protobuf/internal/strs/strings_unsafe.go index 1ffddf6877a..42dd6f70c6f 100644 --- a/vendor/google.golang.org/protobuf/internal/strs/strings_unsafe_go121.go +++ b/vendor/google.golang.org/protobuf/internal/strs/strings_unsafe.go @@ -2,8 +2,6 @@ // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. -//go:build go1.21 - package strs import ( diff --git a/vendor/google.golang.org/protobuf/internal/strs/strings_unsafe_go120.go b/vendor/google.golang.org/protobuf/internal/strs/strings_unsafe_go120.go deleted file mode 100644 index 832a7988f14..00000000000 --- a/vendor/google.golang.org/protobuf/internal/strs/strings_unsafe_go120.go +++ /dev/null @@ -1,94 +0,0 @@ -// Copyright 2018 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -//go:build !go1.21 - -package strs - -import ( - "unsafe" - - "google.golang.org/protobuf/reflect/protoreflect" -) - -type ( - stringHeader struct { - Data unsafe.Pointer - Len int - } - sliceHeader struct { - Data unsafe.Pointer - Len int - Cap int - } -) - -// UnsafeString returns an unsafe string reference of b. -// The caller must treat the input slice as immutable. -// -// WARNING: Use carefully. The returned result must not leak to the end user -// unless the input slice is provably immutable. -func UnsafeString(b []byte) (s string) { - src := (*sliceHeader)(unsafe.Pointer(&b)) - dst := (*stringHeader)(unsafe.Pointer(&s)) - dst.Data = src.Data - dst.Len = src.Len - return s -} - -// UnsafeBytes returns an unsafe bytes slice reference of s. -// The caller must treat returned slice as immutable. -// -// WARNING: Use carefully. The returned result must not leak to the end user. -func UnsafeBytes(s string) (b []byte) { - src := (*stringHeader)(unsafe.Pointer(&s)) - dst := (*sliceHeader)(unsafe.Pointer(&b)) - dst.Data = src.Data - dst.Len = src.Len - dst.Cap = src.Len - return b -} - -// Builder builds a set of strings with shared lifetime. -// This differs from strings.Builder, which is for building a single string. -type Builder struct { - buf []byte -} - -// AppendFullName is equivalent to protoreflect.FullName.Append, -// but optimized for large batches where each name has a shared lifetime. -func (sb *Builder) AppendFullName(prefix protoreflect.FullName, name protoreflect.Name) protoreflect.FullName { - n := len(prefix) + len(".") + len(name) - if len(prefix) == 0 { - n -= len(".") - } - sb.grow(n) - sb.buf = append(sb.buf, prefix...) - sb.buf = append(sb.buf, '.') - sb.buf = append(sb.buf, name...) - return protoreflect.FullName(sb.last(n)) -} - -// MakeString is equivalent to string(b), but optimized for large batches -// with a shared lifetime. -func (sb *Builder) MakeString(b []byte) string { - sb.grow(len(b)) - sb.buf = append(sb.buf, b...) - return sb.last(len(b)) -} - -func (sb *Builder) grow(n int) { - if cap(sb.buf)-len(sb.buf) >= n { - return - } - - // Unlike strings.Builder, we do not need to copy over the contents - // of the old buffer since our builder provides no API for - // retrieving previously created strings. - sb.buf = make([]byte, 0, 2*(cap(sb.buf)+n)) -} - -func (sb *Builder) last(n int) string { - return UnsafeString(sb.buf[len(sb.buf)-n:]) -} diff --git a/vendor/google.golang.org/protobuf/internal/version/version.go b/vendor/google.golang.org/protobuf/internal/version/version.go index 4a39af0c635..aac1cb18a74 100644 --- a/vendor/google.golang.org/protobuf/internal/version/version.go +++ b/vendor/google.golang.org/protobuf/internal/version/version.go @@ -52,7 +52,7 @@ import ( const ( Major = 1 Minor = 36 - Patch = 4 + Patch = 6 PreRelease = "" ) diff --git a/vendor/google.golang.org/protobuf/proto/decode.go b/vendor/google.golang.org/protobuf/proto/decode.go index e28d7acb378..4cbf1aeaf79 100644 --- a/vendor/google.golang.org/protobuf/proto/decode.go +++ b/vendor/google.golang.org/protobuf/proto/decode.go @@ -8,7 +8,6 @@ import ( "google.golang.org/protobuf/encoding/protowire" "google.golang.org/protobuf/internal/encoding/messageset" "google.golang.org/protobuf/internal/errors" - "google.golang.org/protobuf/internal/flags" "google.golang.org/protobuf/internal/genid" "google.golang.org/protobuf/internal/pragma" "google.golang.org/protobuf/reflect/protoreflect" @@ -172,10 +171,6 @@ func (o UnmarshalOptions) unmarshalMessageSlow(b []byte, m protoreflect.Message) var err error if fd == nil { err = errUnknown - } else if flags.ProtoLegacyWeak { - if fd.IsWeak() && fd.Message().IsPlaceholder() { - err = errUnknown // weak referent is not linked in - } } // Parse the field value. diff --git a/vendor/google.golang.org/protobuf/proto/merge.go b/vendor/google.golang.org/protobuf/proto/merge.go index 3c6fe57807b..ef55b97dded 100644 --- a/vendor/google.golang.org/protobuf/proto/merge.go +++ b/vendor/google.golang.org/protobuf/proto/merge.go @@ -59,6 +59,12 @@ func Clone(m Message) Message { return dst.Interface() } +// CloneOf returns a deep copy of m. If the top-level message is invalid, +// it returns an invalid message as well. +func CloneOf[M Message](m M) M { + return Clone(m).(M) +} + // mergeOptions provides a namespace for merge functions, and can be // exported in the future if we add user-visible merge options. type mergeOptions struct{} diff --git a/vendor/google.golang.org/protobuf/reflect/protodesc/desc.go b/vendor/google.golang.org/protobuf/reflect/protodesc/desc.go index 69a05050917..823dbf3ba6c 100644 --- a/vendor/google.golang.org/protobuf/reflect/protodesc/desc.go +++ b/vendor/google.golang.org/protobuf/reflect/protodesc/desc.go @@ -132,17 +132,11 @@ func (o FileOptions) New(fd *descriptorpb.FileDescriptorProto, r Resolver) (prot } f.L2.Imports[i].IsPublic = true } - for _, i := range fd.GetWeakDependency() { - if !(0 <= i && int(i) < len(f.L2.Imports)) || f.L2.Imports[i].IsWeak { - return nil, errors.New("invalid or duplicate weak import index: %d", i) - } - f.L2.Imports[i].IsWeak = true - } imps := importSet{f.Path(): true} for i, path := range fd.GetDependency() { imp := &f.L2.Imports[i] f, err := r.FindFileByPath(path) - if err == protoregistry.NotFound && (o.AllowUnresolvable || imp.IsWeak) { + if err == protoregistry.NotFound && o.AllowUnresolvable { f = filedesc.PlaceholderFile(path) } else if err != nil { return nil, errors.New("could not resolve import %q: %v", path, err) diff --git a/vendor/google.golang.org/protobuf/reflect/protodesc/desc_init.go b/vendor/google.golang.org/protobuf/reflect/protodesc/desc_init.go index ebcb4a8ab13..9da34998b17 100644 --- a/vendor/google.golang.org/protobuf/reflect/protodesc/desc_init.go +++ b/vendor/google.golang.org/protobuf/reflect/protodesc/desc_init.go @@ -149,7 +149,6 @@ func (r descsByName) initFieldsFromDescriptorProto(fds []*descriptorpb.FieldDesc if opts := fd.GetOptions(); opts != nil { opts = proto.Clone(opts).(*descriptorpb.FieldOptions) f.L1.Options = func() protoreflect.ProtoMessage { return opts } - f.L1.IsWeak = opts.GetWeak() f.L1.IsLazy = opts.GetLazy() if opts.Packed != nil { f.L1.EditionFeatures.IsPacked = opts.GetPacked() diff --git a/vendor/google.golang.org/protobuf/reflect/protodesc/desc_resolve.go b/vendor/google.golang.org/protobuf/reflect/protodesc/desc_resolve.go index f3cebab29c8..ff692436e9f 100644 --- a/vendor/google.golang.org/protobuf/reflect/protodesc/desc_resolve.go +++ b/vendor/google.golang.org/protobuf/reflect/protodesc/desc_resolve.go @@ -43,7 +43,7 @@ func (r *resolver) resolveMessageDependencies(ms []filedesc.Message, mds []*desc o.L1.Fields.List = append(o.L1.Fields.List, f) } - if f.L1.Kind, f.L1.Enum, f.L1.Message, err = r.findTarget(f.Kind(), f.Parent().FullName(), partialName(fd.GetTypeName()), f.IsWeak()); err != nil { + if f.L1.Kind, f.L1.Enum, f.L1.Message, err = r.findTarget(f.Kind(), f.Parent().FullName(), partialName(fd.GetTypeName())); err != nil { return errors.New("message field %q cannot resolve type: %v", f.FullName(), err) } if f.L1.Kind == protoreflect.GroupKind && (f.IsMap() || f.IsMapEntry()) { @@ -73,10 +73,10 @@ func (r *resolver) resolveMessageDependencies(ms []filedesc.Message, mds []*desc func (r *resolver) resolveExtensionDependencies(xs []filedesc.Extension, xds []*descriptorpb.FieldDescriptorProto) (err error) { for i, xd := range xds { x := &xs[i] - if x.L1.Extendee, err = r.findMessageDescriptor(x.Parent().FullName(), partialName(xd.GetExtendee()), false); err != nil { + if x.L1.Extendee, err = r.findMessageDescriptor(x.Parent().FullName(), partialName(xd.GetExtendee())); err != nil { return errors.New("extension field %q cannot resolve extendee: %v", x.FullName(), err) } - if x.L1.Kind, x.L2.Enum, x.L2.Message, err = r.findTarget(x.Kind(), x.Parent().FullName(), partialName(xd.GetTypeName()), false); err != nil { + if x.L1.Kind, x.L2.Enum, x.L2.Message, err = r.findTarget(x.Kind(), x.Parent().FullName(), partialName(xd.GetTypeName())); err != nil { return errors.New("extension field %q cannot resolve type: %v", x.FullName(), err) } if xd.DefaultValue != nil { @@ -95,11 +95,11 @@ func (r *resolver) resolveServiceDependencies(ss []filedesc.Service, sds []*desc s := &ss[i] for j, md := range sd.GetMethod() { m := &s.L2.Methods.List[j] - m.L1.Input, err = r.findMessageDescriptor(m.Parent().FullName(), partialName(md.GetInputType()), false) + m.L1.Input, err = r.findMessageDescriptor(m.Parent().FullName(), partialName(md.GetInputType())) if err != nil { return errors.New("service method %q cannot resolve input: %v", m.FullName(), err) } - m.L1.Output, err = r.findMessageDescriptor(s.FullName(), partialName(md.GetOutputType()), false) + m.L1.Output, err = r.findMessageDescriptor(s.FullName(), partialName(md.GetOutputType())) if err != nil { return errors.New("service method %q cannot resolve output: %v", m.FullName(), err) } @@ -111,16 +111,16 @@ func (r *resolver) resolveServiceDependencies(ss []filedesc.Service, sds []*desc // findTarget finds an enum or message descriptor if k is an enum, message, // group, or unknown. If unknown, and the name could be resolved, the kind // returned kind is set based on the type of the resolved descriptor. -func (r *resolver) findTarget(k protoreflect.Kind, scope protoreflect.FullName, ref partialName, isWeak bool) (protoreflect.Kind, protoreflect.EnumDescriptor, protoreflect.MessageDescriptor, error) { +func (r *resolver) findTarget(k protoreflect.Kind, scope protoreflect.FullName, ref partialName) (protoreflect.Kind, protoreflect.EnumDescriptor, protoreflect.MessageDescriptor, error) { switch k { case protoreflect.EnumKind: - ed, err := r.findEnumDescriptor(scope, ref, isWeak) + ed, err := r.findEnumDescriptor(scope, ref) if err != nil { return 0, nil, nil, err } return k, ed, nil, nil case protoreflect.MessageKind, protoreflect.GroupKind: - md, err := r.findMessageDescriptor(scope, ref, isWeak) + md, err := r.findMessageDescriptor(scope, ref) if err != nil { return 0, nil, nil, err } @@ -129,7 +129,7 @@ func (r *resolver) findTarget(k protoreflect.Kind, scope protoreflect.FullName, // Handle unspecified kinds (possible with parsers that operate // on a per-file basis without knowledge of dependencies). d, err := r.findDescriptor(scope, ref) - if err == protoregistry.NotFound && (r.allowUnresolvable || isWeak) { + if err == protoregistry.NotFound && r.allowUnresolvable { return k, filedesc.PlaceholderEnum(ref.FullName()), filedesc.PlaceholderMessage(ref.FullName()), nil } else if err == protoregistry.NotFound { return 0, nil, nil, errors.New("%q not found", ref.FullName()) @@ -206,9 +206,9 @@ func (r *resolver) findDescriptor(scope protoreflect.FullName, ref partialName) } } -func (r *resolver) findEnumDescriptor(scope protoreflect.FullName, ref partialName, isWeak bool) (protoreflect.EnumDescriptor, error) { +func (r *resolver) findEnumDescriptor(scope protoreflect.FullName, ref partialName) (protoreflect.EnumDescriptor, error) { d, err := r.findDescriptor(scope, ref) - if err == protoregistry.NotFound && (r.allowUnresolvable || isWeak) { + if err == protoregistry.NotFound && r.allowUnresolvable { return filedesc.PlaceholderEnum(ref.FullName()), nil } else if err == protoregistry.NotFound { return nil, errors.New("%q not found", ref.FullName()) @@ -222,9 +222,9 @@ func (r *resolver) findEnumDescriptor(scope protoreflect.FullName, ref partialNa return ed, nil } -func (r *resolver) findMessageDescriptor(scope protoreflect.FullName, ref partialName, isWeak bool) (protoreflect.MessageDescriptor, error) { +func (r *resolver) findMessageDescriptor(scope protoreflect.FullName, ref partialName) (protoreflect.MessageDescriptor, error) { d, err := r.findDescriptor(scope, ref) - if err == protoregistry.NotFound && (r.allowUnresolvable || isWeak) { + if err == protoregistry.NotFound && r.allowUnresolvable { return filedesc.PlaceholderMessage(ref.FullName()), nil } else if err == protoregistry.NotFound { return nil, errors.New("%q not found", ref.FullName()) diff --git a/vendor/google.golang.org/protobuf/reflect/protodesc/desc_validate.go b/vendor/google.golang.org/protobuf/reflect/protodesc/desc_validate.go index 5eaf652176c..c343d9227b5 100644 --- a/vendor/google.golang.org/protobuf/reflect/protodesc/desc_validate.go +++ b/vendor/google.golang.org/protobuf/reflect/protodesc/desc_validate.go @@ -149,12 +149,6 @@ func validateMessageDeclarations(file *filedesc.File, ms []filedesc.Message, mds return errors.New("message field %q under proto3 optional semantics must be within a single element oneof", f.FullName()) } } - if f.IsWeak() && !flags.ProtoLegacyWeak { - return errors.New("message field %q is a weak field, which is a legacy proto1 feature that is no longer supported", f.FullName()) - } - if f.IsWeak() && (!f.HasPresence() || !isOptionalMessage(f) || f.ContainingOneof() != nil) { - return errors.New("message field %q may only be weak for an optional message", f.FullName()) - } if f.IsPacked() && !isPackable(f) { return errors.New("message field %q is not packable", f.FullName()) } @@ -199,9 +193,6 @@ func validateMessageDeclarations(file *filedesc.File, ms []filedesc.Message, mds if f.Cardinality() != protoreflect.Optional { return errors.New("message field %q belongs in a oneof and must be optional", f.FullName()) } - if f.IsWeak() { - return errors.New("message field %q belongs in a oneof and must not be a weak reference", f.FullName()) - } } } @@ -254,9 +245,6 @@ func validateExtensionDeclarations(f *filedesc.File, xs []filedesc.Extension, xd return errors.New("extension field %q has an invalid number: %d", x.FullName(), x.Number()) } } - if xd.GetOptions().GetWeak() { - return errors.New("extension field %q cannot be a weak reference", x.FullName()) - } if x.IsPacked() && !isPackable(x) { return errors.New("extension field %q is not packable", x.FullName()) } diff --git a/vendor/google.golang.org/protobuf/reflect/protodesc/proto.go b/vendor/google.golang.org/protobuf/reflect/protodesc/proto.go index a5de8d40013..9b880aa8c96 100644 --- a/vendor/google.golang.org/protobuf/reflect/protodesc/proto.go +++ b/vendor/google.golang.org/protobuf/reflect/protodesc/proto.go @@ -32,9 +32,6 @@ func ToFileDescriptorProto(file protoreflect.FileDescriptor) *descriptorpb.FileD if imp.IsPublic { p.PublicDependency = append(p.PublicDependency, int32(i)) } - if imp.IsWeak { - p.WeakDependency = append(p.WeakDependency, int32(i)) - } } for i, locs := 0, file.SourceLocations(); i < locs.Len(); i++ { loc := locs.Get(i) diff --git a/vendor/google.golang.org/protobuf/reflect/protoreflect/source_gen.go b/vendor/google.golang.org/protobuf/reflect/protoreflect/source_gen.go index ea154eec44d..a4a0a2971dd 100644 --- a/vendor/google.golang.org/protobuf/reflect/protoreflect/source_gen.go +++ b/vendor/google.golang.org/protobuf/reflect/protoreflect/source_gen.go @@ -398,6 +398,8 @@ func (p *SourcePath) appendFeatureSet(b []byte) []byte { b = p.appendSingularField(b, "message_encoding", nil) case 6: b = p.appendSingularField(b, "json_format", nil) + case 7: + b = p.appendSingularField(b, "enforce_naming_style", nil) } return b } diff --git a/vendor/google.golang.org/protobuf/reflect/protoreflect/type.go b/vendor/google.golang.org/protobuf/reflect/protoreflect/type.go index cd8fadbaf8f..cd7fbc87a47 100644 --- a/vendor/google.golang.org/protobuf/reflect/protoreflect/type.go +++ b/vendor/google.golang.org/protobuf/reflect/protoreflect/type.go @@ -68,7 +68,7 @@ type Descriptor interface { // dependency is not resolved, in which case only name information is known. // // Placeholder types may only be returned by the following accessors - // as a result of unresolved dependencies or weak imports: + // as a result of unresolved dependencies: // // ╔═══════════════════════════════════╤═════════════════════╗ // ║ Accessor │ Descriptor ║ @@ -168,11 +168,7 @@ type FileImport struct { // The current file and the imported file must be within proto package. IsPublic bool - // IsWeak reports whether this is a weak import, which does not impose - // a direct dependency on the target file. - // - // Weak imports are a legacy proto1 feature. Equivalent behavior is - // achieved using proto2 extension fields or proto3 Any messages. + // Deprecated: support for weak fields has been removed. IsWeak bool } @@ -325,9 +321,7 @@ type FieldDescriptor interface { // specified in the source .proto file. HasOptionalKeyword() bool - // IsWeak reports whether this is a weak field, which does not impose a - // direct dependency on the target type. - // If true, then Message returns a placeholder type. + // Deprecated: support for weak fields has been removed. IsWeak() bool // IsPacked reports whether repeated primitive numeric kinds should be diff --git a/vendor/google.golang.org/protobuf/reflect/protoreflect/value_unsafe_go121.go b/vendor/google.golang.org/protobuf/reflect/protoreflect/value_unsafe.go similarity index 99% rename from vendor/google.golang.org/protobuf/reflect/protoreflect/value_unsafe_go121.go rename to vendor/google.golang.org/protobuf/reflect/protoreflect/value_unsafe.go index 479527b58dd..fe17f37220e 100644 --- a/vendor/google.golang.org/protobuf/reflect/protoreflect/value_unsafe_go121.go +++ b/vendor/google.golang.org/protobuf/reflect/protoreflect/value_unsafe.go @@ -2,8 +2,6 @@ // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. -//go:build go1.21 - package protoreflect import ( diff --git a/vendor/google.golang.org/protobuf/reflect/protoreflect/value_unsafe_go120.go b/vendor/google.golang.org/protobuf/reflect/protoreflect/value_unsafe_go120.go deleted file mode 100644 index 0015fcb35d8..00000000000 --- a/vendor/google.golang.org/protobuf/reflect/protoreflect/value_unsafe_go120.go +++ /dev/null @@ -1,98 +0,0 @@ -// Copyright 2018 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -//go:build !go1.21 - -package protoreflect - -import ( - "unsafe" - - "google.golang.org/protobuf/internal/pragma" -) - -type ( - stringHeader struct { - Data unsafe.Pointer - Len int - } - sliceHeader struct { - Data unsafe.Pointer - Len int - Cap int - } - ifaceHeader struct { - Type unsafe.Pointer - Data unsafe.Pointer - } -) - -var ( - nilType = typeOf(nil) - boolType = typeOf(*new(bool)) - int32Type = typeOf(*new(int32)) - int64Type = typeOf(*new(int64)) - uint32Type = typeOf(*new(uint32)) - uint64Type = typeOf(*new(uint64)) - float32Type = typeOf(*new(float32)) - float64Type = typeOf(*new(float64)) - stringType = typeOf(*new(string)) - bytesType = typeOf(*new([]byte)) - enumType = typeOf(*new(EnumNumber)) -) - -// typeOf returns a pointer to the Go type information. -// The pointer is comparable and equal if and only if the types are identical. -func typeOf(t any) unsafe.Pointer { - return (*ifaceHeader)(unsafe.Pointer(&t)).Type -} - -// value is a union where only one type can be represented at a time. -// The struct is 24B large on 64-bit systems and requires the minimum storage -// necessary to represent each possible type. -// -// The Go GC needs to be able to scan variables containing pointers. -// As such, pointers and non-pointers cannot be intermixed. -type value struct { - pragma.DoNotCompare // 0B - - // typ stores the type of the value as a pointer to the Go type. - typ unsafe.Pointer // 8B - - // ptr stores the data pointer for a String, Bytes, or interface value. - ptr unsafe.Pointer // 8B - - // num stores a Bool, Int32, Int64, Uint32, Uint64, Float32, Float64, or - // Enum value as a raw uint64. - // - // It is also used to store the length of a String or Bytes value; - // the capacity is ignored. - num uint64 // 8B -} - -func valueOfString(v string) Value { - p := (*stringHeader)(unsafe.Pointer(&v)) - return Value{typ: stringType, ptr: p.Data, num: uint64(len(v))} -} -func valueOfBytes(v []byte) Value { - p := (*sliceHeader)(unsafe.Pointer(&v)) - return Value{typ: bytesType, ptr: p.Data, num: uint64(len(v))} -} -func valueOfIface(v any) Value { - p := (*ifaceHeader)(unsafe.Pointer(&v)) - return Value{typ: p.Type, ptr: p.Data} -} - -func (v Value) getString() (x string) { - *(*stringHeader)(unsafe.Pointer(&x)) = stringHeader{Data: v.ptr, Len: int(v.num)} - return x -} -func (v Value) getBytes() (x []byte) { - *(*sliceHeader)(unsafe.Pointer(&x)) = sliceHeader{Data: v.ptr, Len: int(v.num), Cap: int(v.num)} - return x -} -func (v Value) getIface() (x any) { - *(*ifaceHeader)(unsafe.Pointer(&x)) = ifaceHeader{Type: v.typ, Data: v.ptr} - return x -} diff --git a/vendor/google.golang.org/protobuf/types/descriptorpb/descriptor.pb.go b/vendor/google.golang.org/protobuf/types/descriptorpb/descriptor.pb.go index a5163376741..7fe280f194c 100644 --- a/vendor/google.golang.org/protobuf/types/descriptorpb/descriptor.pb.go +++ b/vendor/google.golang.org/protobuf/types/descriptorpb/descriptor.pb.go @@ -1139,6 +1139,65 @@ func (FeatureSet_JsonFormat) EnumDescriptor() ([]byte, []int) { return file_google_protobuf_descriptor_proto_rawDescGZIP(), []int{19, 5} } +type FeatureSet_EnforceNamingStyle int32 + +const ( + FeatureSet_ENFORCE_NAMING_STYLE_UNKNOWN FeatureSet_EnforceNamingStyle = 0 + FeatureSet_STYLE2024 FeatureSet_EnforceNamingStyle = 1 + FeatureSet_STYLE_LEGACY FeatureSet_EnforceNamingStyle = 2 +) + +// Enum value maps for FeatureSet_EnforceNamingStyle. +var ( + FeatureSet_EnforceNamingStyle_name = map[int32]string{ + 0: "ENFORCE_NAMING_STYLE_UNKNOWN", + 1: "STYLE2024", + 2: "STYLE_LEGACY", + } + FeatureSet_EnforceNamingStyle_value = map[string]int32{ + "ENFORCE_NAMING_STYLE_UNKNOWN": 0, + "STYLE2024": 1, + "STYLE_LEGACY": 2, + } +) + +func (x FeatureSet_EnforceNamingStyle) Enum() *FeatureSet_EnforceNamingStyle { + p := new(FeatureSet_EnforceNamingStyle) + *p = x + return p +} + +func (x FeatureSet_EnforceNamingStyle) String() string { + return protoimpl.X.EnumStringOf(x.Descriptor(), protoreflect.EnumNumber(x)) +} + +func (FeatureSet_EnforceNamingStyle) Descriptor() protoreflect.EnumDescriptor { + return file_google_protobuf_descriptor_proto_enumTypes[16].Descriptor() +} + +func (FeatureSet_EnforceNamingStyle) Type() protoreflect.EnumType { + return &file_google_protobuf_descriptor_proto_enumTypes[16] +} + +func (x FeatureSet_EnforceNamingStyle) Number() protoreflect.EnumNumber { + return protoreflect.EnumNumber(x) +} + +// Deprecated: Do not use. +func (x *FeatureSet_EnforceNamingStyle) UnmarshalJSON(b []byte) error { + num, err := protoimpl.X.UnmarshalJSONEnum(x.Descriptor(), b) + if err != nil { + return err + } + *x = FeatureSet_EnforceNamingStyle(num) + return nil +} + +// Deprecated: Use FeatureSet_EnforceNamingStyle.Descriptor instead. +func (FeatureSet_EnforceNamingStyle) EnumDescriptor() ([]byte, []int) { + return file_google_protobuf_descriptor_proto_rawDescGZIP(), []int{19, 6} +} + // Represents the identified object's effect on the element in the original // .proto file. type GeneratedCodeInfo_Annotation_Semantic int32 @@ -1177,11 +1236,11 @@ func (x GeneratedCodeInfo_Annotation_Semantic) String() string { } func (GeneratedCodeInfo_Annotation_Semantic) Descriptor() protoreflect.EnumDescriptor { - return file_google_protobuf_descriptor_proto_enumTypes[16].Descriptor() + return file_google_protobuf_descriptor_proto_enumTypes[17].Descriptor() } func (GeneratedCodeInfo_Annotation_Semantic) Type() protoreflect.EnumType { - return &file_google_protobuf_descriptor_proto_enumTypes[16] + return &file_google_protobuf_descriptor_proto_enumTypes[17] } func (x GeneratedCodeInfo_Annotation_Semantic) Number() protoreflect.EnumNumber { @@ -1277,8 +1336,14 @@ type FileDescriptorProto struct { // The supported values are "proto2", "proto3", and "editions". // // If `edition` is present, this value must be "editions". + // WARNING: This field should only be used by protobuf plugins or special + // cases like the proto compiler. Other uses are discouraged and + // developers should rely on the protoreflect APIs for their client language. Syntax *string `protobuf:"bytes,12,opt,name=syntax" json:"syntax,omitempty"` // The edition of the proto file. + // WARNING: This field should only be used by protobuf plugins or special + // cases like the proto compiler. Other uses are discouraged and + // developers should rely on the protoreflect APIs for their client language. Edition *Edition `protobuf:"varint,14,opt,name=edition,enum=google.protobuf.Edition" json:"edition,omitempty"` unknownFields protoimpl.UnknownFields sizeCache protoimpl.SizeCache @@ -2212,6 +2277,9 @@ type FileOptions struct { // determining the ruby package. RubyPackage *string `protobuf:"bytes,45,opt,name=ruby_package,json=rubyPackage" json:"ruby_package,omitempty"` // Any features defined in the specific edition. + // WARNING: This field should only be used by protobuf plugins or special + // cases like the proto compiler. Other uses are discouraged and + // developers should rely on the protoreflect APIs for their client language. Features *FeatureSet `protobuf:"bytes,50,opt,name=features" json:"features,omitempty"` // The parser stores options it doesn't recognize here. // See the documentation for the "Options" section above. @@ -2482,6 +2550,9 @@ type MessageOptions struct { // Deprecated: Marked as deprecated in google/protobuf/descriptor.proto. DeprecatedLegacyJsonFieldConflicts *bool `protobuf:"varint,11,opt,name=deprecated_legacy_json_field_conflicts,json=deprecatedLegacyJsonFieldConflicts" json:"deprecated_legacy_json_field_conflicts,omitempty"` // Any features defined in the specific edition. + // WARNING: This field should only be used by protobuf plugins or special + // cases like the proto compiler. Other uses are discouraged and + // developers should rely on the protoreflect APIs for their client language. Features *FeatureSet `protobuf:"bytes,12,opt,name=features" json:"features,omitempty"` // The parser stores options it doesn't recognize here. See above. UninterpretedOption []*UninterpretedOption `protobuf:"bytes,999,rep,name=uninterpreted_option,json=uninterpretedOption" json:"uninterpreted_option,omitempty"` @@ -2648,6 +2719,9 @@ type FieldOptions struct { Targets []FieldOptions_OptionTargetType `protobuf:"varint,19,rep,name=targets,enum=google.protobuf.FieldOptions_OptionTargetType" json:"targets,omitempty"` EditionDefaults []*FieldOptions_EditionDefault `protobuf:"bytes,20,rep,name=edition_defaults,json=editionDefaults" json:"edition_defaults,omitempty"` // Any features defined in the specific edition. + // WARNING: This field should only be used by protobuf plugins or special + // cases like the proto compiler. Other uses are discouraged and + // developers should rely on the protoreflect APIs for their client language. Features *FeatureSet `protobuf:"bytes,21,opt,name=features" json:"features,omitempty"` FeatureSupport *FieldOptions_FeatureSupport `protobuf:"bytes,22,opt,name=feature_support,json=featureSupport" json:"feature_support,omitempty"` // The parser stores options it doesn't recognize here. See above. @@ -2799,6 +2873,9 @@ func (x *FieldOptions) GetUninterpretedOption() []*UninterpretedOption { type OneofOptions struct { state protoimpl.MessageState `protogen:"open.v1"` // Any features defined in the specific edition. + // WARNING: This field should only be used by protobuf plugins or special + // cases like the proto compiler. Other uses are discouraged and + // developers should rely on the protoreflect APIs for their client language. Features *FeatureSet `protobuf:"bytes,1,opt,name=features" json:"features,omitempty"` // The parser stores options it doesn't recognize here. See above. UninterpretedOption []*UninterpretedOption `protobuf:"bytes,999,rep,name=uninterpreted_option,json=uninterpretedOption" json:"uninterpreted_option,omitempty"` @@ -2871,6 +2948,9 @@ type EnumOptions struct { // Deprecated: Marked as deprecated in google/protobuf/descriptor.proto. DeprecatedLegacyJsonFieldConflicts *bool `protobuf:"varint,6,opt,name=deprecated_legacy_json_field_conflicts,json=deprecatedLegacyJsonFieldConflicts" json:"deprecated_legacy_json_field_conflicts,omitempty"` // Any features defined in the specific edition. + // WARNING: This field should only be used by protobuf plugins or special + // cases like the proto compiler. Other uses are discouraged and + // developers should rely on the protoreflect APIs for their client language. Features *FeatureSet `protobuf:"bytes,7,opt,name=features" json:"features,omitempty"` // The parser stores options it doesn't recognize here. See above. UninterpretedOption []*UninterpretedOption `protobuf:"bytes,999,rep,name=uninterpreted_option,json=uninterpretedOption" json:"uninterpreted_option,omitempty"` @@ -2958,6 +3038,9 @@ type EnumValueOptions struct { // this is a formalization for deprecating enum values. Deprecated *bool `protobuf:"varint,1,opt,name=deprecated,def=0" json:"deprecated,omitempty"` // Any features defined in the specific edition. + // WARNING: This field should only be used by protobuf plugins or special + // cases like the proto compiler. Other uses are discouraged and + // developers should rely on the protoreflect APIs for their client language. Features *FeatureSet `protobuf:"bytes,2,opt,name=features" json:"features,omitempty"` // Indicate that fields annotated with this enum value should not be printed // out when using debug formats, e.g. when the field contains sensitive @@ -3046,6 +3129,9 @@ func (x *EnumValueOptions) GetUninterpretedOption() []*UninterpretedOption { type ServiceOptions struct { state protoimpl.MessageState `protogen:"open.v1"` // Any features defined in the specific edition. + // WARNING: This field should only be used by protobuf plugins or special + // cases like the proto compiler. Other uses are discouraged and + // developers should rely on the protoreflect APIs for their client language. Features *FeatureSet `protobuf:"bytes,34,opt,name=features" json:"features,omitempty"` // Is this service deprecated? // Depending on the target platform, this can emit Deprecated annotations @@ -3124,6 +3210,9 @@ type MethodOptions struct { Deprecated *bool `protobuf:"varint,33,opt,name=deprecated,def=0" json:"deprecated,omitempty"` IdempotencyLevel *MethodOptions_IdempotencyLevel `protobuf:"varint,34,opt,name=idempotency_level,json=idempotencyLevel,enum=google.protobuf.MethodOptions_IdempotencyLevel,def=0" json:"idempotency_level,omitempty"` // Any features defined in the specific edition. + // WARNING: This field should only be used by protobuf plugins or special + // cases like the proto compiler. Other uses are discouraged and + // developers should rely on the protoreflect APIs for their client language. Features *FeatureSet `protobuf:"bytes,35,opt,name=features" json:"features,omitempty"` // The parser stores options it doesn't recognize here. See above. UninterpretedOption []*UninterpretedOption `protobuf:"bytes,999,rep,name=uninterpreted_option,json=uninterpretedOption" json:"uninterpreted_option,omitempty"` @@ -3310,6 +3399,7 @@ type FeatureSet struct { Utf8Validation *FeatureSet_Utf8Validation `protobuf:"varint,4,opt,name=utf8_validation,json=utf8Validation,enum=google.protobuf.FeatureSet_Utf8Validation" json:"utf8_validation,omitempty"` MessageEncoding *FeatureSet_MessageEncoding `protobuf:"varint,5,opt,name=message_encoding,json=messageEncoding,enum=google.protobuf.FeatureSet_MessageEncoding" json:"message_encoding,omitempty"` JsonFormat *FeatureSet_JsonFormat `protobuf:"varint,6,opt,name=json_format,json=jsonFormat,enum=google.protobuf.FeatureSet_JsonFormat" json:"json_format,omitempty"` + EnforceNamingStyle *FeatureSet_EnforceNamingStyle `protobuf:"varint,7,opt,name=enforce_naming_style,json=enforceNamingStyle,enum=google.protobuf.FeatureSet_EnforceNamingStyle" json:"enforce_naming_style,omitempty"` extensionFields protoimpl.ExtensionFields unknownFields protoimpl.UnknownFields sizeCache protoimpl.SizeCache @@ -3387,6 +3477,13 @@ func (x *FeatureSet) GetJsonFormat() FeatureSet_JsonFormat { return FeatureSet_JSON_FORMAT_UNKNOWN } +func (x *FeatureSet) GetEnforceNamingStyle() FeatureSet_EnforceNamingStyle { + if x != nil && x.EnforceNamingStyle != nil { + return *x.EnforceNamingStyle + } + return FeatureSet_ENFORCE_NAMING_STYLE_UNKNOWN +} + // A compiled specification for the defaults of a set of features. These // messages are generated from FeatureSet extensions and can be used to seed // feature resolution. The resolution with this object becomes a simple search @@ -4361,777 +4458,367 @@ func (x *GeneratedCodeInfo_Annotation) GetSemantic() GeneratedCodeInfo_Annotatio var File_google_protobuf_descriptor_proto protoreflect.FileDescriptor -var file_google_protobuf_descriptor_proto_rawDesc = string([]byte{ - 0x0a, 0x20, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2f, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, - 0x66, 0x2f, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x2e, 0x70, 0x72, 0x6f, - 0x74, 0x6f, 0x12, 0x0f, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, - 0x62, 0x75, 0x66, 0x22, 0x5b, 0x0a, 0x11, 0x46, 0x69, 0x6c, 0x65, 0x44, 0x65, 0x73, 0x63, 0x72, - 0x69, 0x70, 0x74, 0x6f, 0x72, 0x53, 0x65, 0x74, 0x12, 0x38, 0x0a, 0x04, 0x66, 0x69, 0x6c, 0x65, - 0x18, 0x01, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x24, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, - 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x69, 0x6c, 0x65, 0x44, 0x65, 0x73, - 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x52, 0x04, 0x66, 0x69, - 0x6c, 0x65, 0x2a, 0x0c, 0x08, 0x80, 0xec, 0xca, 0xff, 0x01, 0x10, 0x81, 0xec, 0xca, 0xff, 0x01, - 0x22, 0x98, 0x05, 0x0a, 0x13, 0x46, 0x69, 0x6c, 0x65, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, - 0x74, 0x6f, 0x72, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x12, 0x12, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, - 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x18, 0x0a, 0x07, - 0x70, 0x61, 0x63, 0x6b, 0x61, 0x67, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x07, 0x70, - 0x61, 0x63, 0x6b, 0x61, 0x67, 0x65, 0x12, 0x1e, 0x0a, 0x0a, 0x64, 0x65, 0x70, 0x65, 0x6e, 0x64, - 0x65, 0x6e, 0x63, 0x79, 0x18, 0x03, 0x20, 0x03, 0x28, 0x09, 0x52, 0x0a, 0x64, 0x65, 0x70, 0x65, - 0x6e, 0x64, 0x65, 0x6e, 0x63, 0x79, 0x12, 0x2b, 0x0a, 0x11, 0x70, 0x75, 0x62, 0x6c, 0x69, 0x63, - 0x5f, 0x64, 0x65, 0x70, 0x65, 0x6e, 0x64, 0x65, 0x6e, 0x63, 0x79, 0x18, 0x0a, 0x20, 0x03, 0x28, - 0x05, 0x52, 0x10, 0x70, 0x75, 0x62, 0x6c, 0x69, 0x63, 0x44, 0x65, 0x70, 0x65, 0x6e, 0x64, 0x65, - 0x6e, 0x63, 0x79, 0x12, 0x27, 0x0a, 0x0f, 0x77, 0x65, 0x61, 0x6b, 0x5f, 0x64, 0x65, 0x70, 0x65, - 0x6e, 0x64, 0x65, 0x6e, 0x63, 0x79, 0x18, 0x0b, 0x20, 0x03, 0x28, 0x05, 0x52, 0x0e, 0x77, 0x65, - 0x61, 0x6b, 0x44, 0x65, 0x70, 0x65, 0x6e, 0x64, 0x65, 0x6e, 0x63, 0x79, 0x12, 0x43, 0x0a, 0x0c, - 0x6d, 0x65, 0x73, 0x73, 0x61, 0x67, 0x65, 0x5f, 0x74, 0x79, 0x70, 0x65, 0x18, 0x04, 0x20, 0x03, - 0x28, 0x0b, 0x32, 0x20, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, - 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x50, - 0x72, 0x6f, 0x74, 0x6f, 0x52, 0x0b, 0x6d, 0x65, 0x73, 0x73, 0x61, 0x67, 0x65, 0x54, 0x79, 0x70, - 0x65, 0x12, 0x41, 0x0a, 0x09, 0x65, 0x6e, 0x75, 0x6d, 0x5f, 0x74, 0x79, 0x70, 0x65, 0x18, 0x05, - 0x20, 0x03, 0x28, 0x0b, 0x32, 0x24, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, - 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x45, 0x6e, 0x75, 0x6d, 0x44, 0x65, 0x73, 0x63, 0x72, - 0x69, 0x70, 0x74, 0x6f, 0x72, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x52, 0x08, 0x65, 0x6e, 0x75, 0x6d, - 0x54, 0x79, 0x70, 0x65, 0x12, 0x41, 0x0a, 0x07, 0x73, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x18, - 0x06, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x27, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, - 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x53, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x44, - 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x52, 0x07, - 0x73, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x12, 0x43, 0x0a, 0x09, 0x65, 0x78, 0x74, 0x65, 0x6e, - 0x73, 0x69, 0x6f, 0x6e, 0x18, 0x07, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x25, 0x2e, 0x67, 0x6f, 0x6f, - 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x69, 0x65, - 0x6c, 0x64, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x50, 0x72, 0x6f, 0x74, - 0x6f, 0x52, 0x09, 0x65, 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x12, 0x36, 0x0a, 0x07, - 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x18, 0x08, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1c, 0x2e, - 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, - 0x46, 0x69, 0x6c, 0x65, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x52, 0x07, 0x6f, 0x70, 0x74, - 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x49, 0x0a, 0x10, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x5f, 0x63, - 0x6f, 0x64, 0x65, 0x5f, 0x69, 0x6e, 0x66, 0x6f, 0x18, 0x09, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1f, - 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, - 0x2e, 0x53, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x43, 0x6f, 0x64, 0x65, 0x49, 0x6e, 0x66, 0x6f, 0x52, - 0x0e, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x43, 0x6f, 0x64, 0x65, 0x49, 0x6e, 0x66, 0x6f, 0x12, - 0x16, 0x0a, 0x06, 0x73, 0x79, 0x6e, 0x74, 0x61, 0x78, 0x18, 0x0c, 0x20, 0x01, 0x28, 0x09, 0x52, - 0x06, 0x73, 0x79, 0x6e, 0x74, 0x61, 0x78, 0x12, 0x32, 0x0a, 0x07, 0x65, 0x64, 0x69, 0x74, 0x69, - 0x6f, 0x6e, 0x18, 0x0e, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x18, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, - 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x45, 0x64, 0x69, 0x74, 0x69, - 0x6f, 0x6e, 0x52, 0x07, 0x65, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x22, 0xb9, 0x06, 0x0a, 0x0f, - 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x12, - 0x12, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x04, 0x6e, - 0x61, 0x6d, 0x65, 0x12, 0x3b, 0x0a, 0x05, 0x66, 0x69, 0x65, 0x6c, 0x64, 0x18, 0x02, 0x20, 0x03, - 0x28, 0x0b, 0x32, 0x25, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, - 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x69, 0x65, 0x6c, 0x64, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, - 0x70, 0x74, 0x6f, 0x72, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x52, 0x05, 0x66, 0x69, 0x65, 0x6c, 0x64, - 0x12, 0x43, 0x0a, 0x09, 0x65, 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x18, 0x06, 0x20, - 0x03, 0x28, 0x0b, 0x32, 0x25, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, - 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x69, 0x65, 0x6c, 0x64, 0x44, 0x65, 0x73, 0x63, 0x72, - 0x69, 0x70, 0x74, 0x6f, 0x72, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x52, 0x09, 0x65, 0x78, 0x74, 0x65, - 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x12, 0x41, 0x0a, 0x0b, 0x6e, 0x65, 0x73, 0x74, 0x65, 0x64, 0x5f, - 0x74, 0x79, 0x70, 0x65, 0x18, 0x03, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x20, 0x2e, 0x67, 0x6f, 0x6f, - 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x44, 0x65, 0x73, - 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x52, 0x0a, 0x6e, 0x65, - 0x73, 0x74, 0x65, 0x64, 0x54, 0x79, 0x70, 0x65, 0x12, 0x41, 0x0a, 0x09, 0x65, 0x6e, 0x75, 0x6d, - 0x5f, 0x74, 0x79, 0x70, 0x65, 0x18, 0x04, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x24, 0x2e, 0x67, 0x6f, - 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x45, 0x6e, - 0x75, 0x6d, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x50, 0x72, 0x6f, 0x74, - 0x6f, 0x52, 0x08, 0x65, 0x6e, 0x75, 0x6d, 0x54, 0x79, 0x70, 0x65, 0x12, 0x58, 0x0a, 0x0f, 0x65, - 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x5f, 0x72, 0x61, 0x6e, 0x67, 0x65, 0x18, 0x05, - 0x20, 0x03, 0x28, 0x0b, 0x32, 0x2f, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, - 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, - 0x72, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x2e, 0x45, 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, - 0x52, 0x61, 0x6e, 0x67, 0x65, 0x52, 0x0e, 0x65, 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, - 0x52, 0x61, 0x6e, 0x67, 0x65, 0x12, 0x44, 0x0a, 0x0a, 0x6f, 0x6e, 0x65, 0x6f, 0x66, 0x5f, 0x64, - 0x65, 0x63, 0x6c, 0x18, 0x08, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x25, 0x2e, 0x67, 0x6f, 0x6f, 0x67, - 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x4f, 0x6e, 0x65, 0x6f, - 0x66, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x50, 0x72, 0x6f, 0x74, 0x6f, - 0x52, 0x09, 0x6f, 0x6e, 0x65, 0x6f, 0x66, 0x44, 0x65, 0x63, 0x6c, 0x12, 0x39, 0x0a, 0x07, 0x6f, - 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x18, 0x07, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1f, 0x2e, 0x67, - 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x4d, - 0x65, 0x73, 0x73, 0x61, 0x67, 0x65, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x52, 0x07, 0x6f, - 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x55, 0x0a, 0x0e, 0x72, 0x65, 0x73, 0x65, 0x72, 0x76, - 0x65, 0x64, 0x5f, 0x72, 0x61, 0x6e, 0x67, 0x65, 0x18, 0x09, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x2e, - 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, - 0x2e, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x50, 0x72, 0x6f, 0x74, 0x6f, - 0x2e, 0x52, 0x65, 0x73, 0x65, 0x72, 0x76, 0x65, 0x64, 0x52, 0x61, 0x6e, 0x67, 0x65, 0x52, 0x0d, - 0x72, 0x65, 0x73, 0x65, 0x72, 0x76, 0x65, 0x64, 0x52, 0x61, 0x6e, 0x67, 0x65, 0x12, 0x23, 0x0a, - 0x0d, 0x72, 0x65, 0x73, 0x65, 0x72, 0x76, 0x65, 0x64, 0x5f, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x0a, - 0x20, 0x03, 0x28, 0x09, 0x52, 0x0c, 0x72, 0x65, 0x73, 0x65, 0x72, 0x76, 0x65, 0x64, 0x4e, 0x61, - 0x6d, 0x65, 0x1a, 0x7a, 0x0a, 0x0e, 0x45, 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x52, - 0x61, 0x6e, 0x67, 0x65, 0x12, 0x14, 0x0a, 0x05, 0x73, 0x74, 0x61, 0x72, 0x74, 0x18, 0x01, 0x20, - 0x01, 0x28, 0x05, 0x52, 0x05, 0x73, 0x74, 0x61, 0x72, 0x74, 0x12, 0x10, 0x0a, 0x03, 0x65, 0x6e, - 0x64, 0x18, 0x02, 0x20, 0x01, 0x28, 0x05, 0x52, 0x03, 0x65, 0x6e, 0x64, 0x12, 0x40, 0x0a, 0x07, - 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x18, 0x03, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x26, 0x2e, - 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, - 0x45, 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x52, 0x61, 0x6e, 0x67, 0x65, 0x4f, 0x70, - 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x52, 0x07, 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x1a, 0x37, - 0x0a, 0x0d, 0x52, 0x65, 0x73, 0x65, 0x72, 0x76, 0x65, 0x64, 0x52, 0x61, 0x6e, 0x67, 0x65, 0x12, - 0x14, 0x0a, 0x05, 0x73, 0x74, 0x61, 0x72, 0x74, 0x18, 0x01, 0x20, 0x01, 0x28, 0x05, 0x52, 0x05, - 0x73, 0x74, 0x61, 0x72, 0x74, 0x12, 0x10, 0x0a, 0x03, 0x65, 0x6e, 0x64, 0x18, 0x02, 0x20, 0x01, - 0x28, 0x05, 0x52, 0x03, 0x65, 0x6e, 0x64, 0x22, 0xcc, 0x04, 0x0a, 0x15, 0x45, 0x78, 0x74, 0x65, - 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x52, 0x61, 0x6e, 0x67, 0x65, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, - 0x73, 0x12, 0x58, 0x0a, 0x14, 0x75, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, - 0x65, 0x64, 0x5f, 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0xe7, 0x07, 0x20, 0x03, 0x28, 0x0b, - 0x32, 0x24, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, - 0x75, 0x66, 0x2e, 0x55, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, 0x64, - 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x13, 0x75, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, - 0x72, 0x65, 0x74, 0x65, 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x59, 0x0a, 0x0b, 0x64, - 0x65, 0x63, 0x6c, 0x61, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x02, 0x20, 0x03, 0x28, 0x0b, - 0x32, 0x32, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, - 0x75, 0x66, 0x2e, 0x45, 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x52, 0x61, 0x6e, 0x67, - 0x65, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x2e, 0x44, 0x65, 0x63, 0x6c, 0x61, 0x72, 0x61, - 0x74, 0x69, 0x6f, 0x6e, 0x42, 0x03, 0x88, 0x01, 0x02, 0x52, 0x0b, 0x64, 0x65, 0x63, 0x6c, 0x61, - 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x37, 0x0a, 0x08, 0x66, 0x65, 0x61, 0x74, 0x75, 0x72, - 0x65, 0x73, 0x18, 0x32, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1b, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, - 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x65, 0x61, 0x74, 0x75, - 0x72, 0x65, 0x53, 0x65, 0x74, 0x52, 0x08, 0x66, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x73, 0x12, - 0x6d, 0x0a, 0x0c, 0x76, 0x65, 0x72, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x18, - 0x03, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x38, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, - 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x45, 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f, - 0x6e, 0x52, 0x61, 0x6e, 0x67, 0x65, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x2e, 0x56, 0x65, - 0x72, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x53, 0x74, 0x61, 0x74, 0x65, 0x3a, - 0x0a, 0x55, 0x4e, 0x56, 0x45, 0x52, 0x49, 0x46, 0x49, 0x45, 0x44, 0x42, 0x03, 0x88, 0x01, 0x02, - 0x52, 0x0c, 0x76, 0x65, 0x72, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x1a, 0x94, - 0x01, 0x0a, 0x0b, 0x44, 0x65, 0x63, 0x6c, 0x61, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x16, - 0x0a, 0x06, 0x6e, 0x75, 0x6d, 0x62, 0x65, 0x72, 0x18, 0x01, 0x20, 0x01, 0x28, 0x05, 0x52, 0x06, - 0x6e, 0x75, 0x6d, 0x62, 0x65, 0x72, 0x12, 0x1b, 0x0a, 0x09, 0x66, 0x75, 0x6c, 0x6c, 0x5f, 0x6e, - 0x61, 0x6d, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x08, 0x66, 0x75, 0x6c, 0x6c, 0x4e, - 0x61, 0x6d, 0x65, 0x12, 0x12, 0x0a, 0x04, 0x74, 0x79, 0x70, 0x65, 0x18, 0x03, 0x20, 0x01, 0x28, - 0x09, 0x52, 0x04, 0x74, 0x79, 0x70, 0x65, 0x12, 0x1a, 0x0a, 0x08, 0x72, 0x65, 0x73, 0x65, 0x72, - 0x76, 0x65, 0x64, 0x18, 0x05, 0x20, 0x01, 0x28, 0x08, 0x52, 0x08, 0x72, 0x65, 0x73, 0x65, 0x72, - 0x76, 0x65, 0x64, 0x12, 0x1a, 0x0a, 0x08, 0x72, 0x65, 0x70, 0x65, 0x61, 0x74, 0x65, 0x64, 0x18, - 0x06, 0x20, 0x01, 0x28, 0x08, 0x52, 0x08, 0x72, 0x65, 0x70, 0x65, 0x61, 0x74, 0x65, 0x64, 0x4a, - 0x04, 0x08, 0x04, 0x10, 0x05, 0x22, 0x34, 0x0a, 0x11, 0x56, 0x65, 0x72, 0x69, 0x66, 0x69, 0x63, - 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x53, 0x74, 0x61, 0x74, 0x65, 0x12, 0x0f, 0x0a, 0x0b, 0x44, 0x45, - 0x43, 0x4c, 0x41, 0x52, 0x41, 0x54, 0x49, 0x4f, 0x4e, 0x10, 0x00, 0x12, 0x0e, 0x0a, 0x0a, 0x55, - 0x4e, 0x56, 0x45, 0x52, 0x49, 0x46, 0x49, 0x45, 0x44, 0x10, 0x01, 0x2a, 0x09, 0x08, 0xe8, 0x07, - 0x10, 0x80, 0x80, 0x80, 0x80, 0x02, 0x22, 0xc1, 0x06, 0x0a, 0x14, 0x46, 0x69, 0x65, 0x6c, 0x64, - 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x12, - 0x12, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x04, 0x6e, - 0x61, 0x6d, 0x65, 0x12, 0x16, 0x0a, 0x06, 0x6e, 0x75, 0x6d, 0x62, 0x65, 0x72, 0x18, 0x03, 0x20, - 0x01, 0x28, 0x05, 0x52, 0x06, 0x6e, 0x75, 0x6d, 0x62, 0x65, 0x72, 0x12, 0x41, 0x0a, 0x05, 0x6c, - 0x61, 0x62, 0x65, 0x6c, 0x18, 0x04, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x2b, 0x2e, 0x67, 0x6f, 0x6f, - 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x69, 0x65, - 0x6c, 0x64, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x50, 0x72, 0x6f, 0x74, - 0x6f, 0x2e, 0x4c, 0x61, 0x62, 0x65, 0x6c, 0x52, 0x05, 0x6c, 0x61, 0x62, 0x65, 0x6c, 0x12, 0x3e, - 0x0a, 0x04, 0x74, 0x79, 0x70, 0x65, 0x18, 0x05, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x2a, 0x2e, 0x67, - 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, - 0x69, 0x65, 0x6c, 0x64, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x50, 0x72, - 0x6f, 0x74, 0x6f, 0x2e, 0x54, 0x79, 0x70, 0x65, 0x52, 0x04, 0x74, 0x79, 0x70, 0x65, 0x12, 0x1b, - 0x0a, 0x09, 0x74, 0x79, 0x70, 0x65, 0x5f, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x06, 0x20, 0x01, 0x28, - 0x09, 0x52, 0x08, 0x74, 0x79, 0x70, 0x65, 0x4e, 0x61, 0x6d, 0x65, 0x12, 0x1a, 0x0a, 0x08, 0x65, - 0x78, 0x74, 0x65, 0x6e, 0x64, 0x65, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x08, 0x65, - 0x78, 0x74, 0x65, 0x6e, 0x64, 0x65, 0x65, 0x12, 0x23, 0x0a, 0x0d, 0x64, 0x65, 0x66, 0x61, 0x75, - 0x6c, 0x74, 0x5f, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x07, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0c, - 0x64, 0x65, 0x66, 0x61, 0x75, 0x6c, 0x74, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x12, 0x1f, 0x0a, 0x0b, - 0x6f, 0x6e, 0x65, 0x6f, 0x66, 0x5f, 0x69, 0x6e, 0x64, 0x65, 0x78, 0x18, 0x09, 0x20, 0x01, 0x28, - 0x05, 0x52, 0x0a, 0x6f, 0x6e, 0x65, 0x6f, 0x66, 0x49, 0x6e, 0x64, 0x65, 0x78, 0x12, 0x1b, 0x0a, - 0x09, 0x6a, 0x73, 0x6f, 0x6e, 0x5f, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x0a, 0x20, 0x01, 0x28, 0x09, - 0x52, 0x08, 0x6a, 0x73, 0x6f, 0x6e, 0x4e, 0x61, 0x6d, 0x65, 0x12, 0x37, 0x0a, 0x07, 0x6f, 0x70, - 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x18, 0x08, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1d, 0x2e, 0x67, 0x6f, - 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x69, - 0x65, 0x6c, 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x52, 0x07, 0x6f, 0x70, 0x74, 0x69, - 0x6f, 0x6e, 0x73, 0x12, 0x27, 0x0a, 0x0f, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x33, 0x5f, 0x6f, 0x70, - 0x74, 0x69, 0x6f, 0x6e, 0x61, 0x6c, 0x18, 0x11, 0x20, 0x01, 0x28, 0x08, 0x52, 0x0e, 0x70, 0x72, - 0x6f, 0x74, 0x6f, 0x33, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x61, 0x6c, 0x22, 0xb6, 0x02, 0x0a, - 0x04, 0x54, 0x79, 0x70, 0x65, 0x12, 0x0f, 0x0a, 0x0b, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x44, 0x4f, - 0x55, 0x42, 0x4c, 0x45, 0x10, 0x01, 0x12, 0x0e, 0x0a, 0x0a, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x46, - 0x4c, 0x4f, 0x41, 0x54, 0x10, 0x02, 0x12, 0x0e, 0x0a, 0x0a, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x49, - 0x4e, 0x54, 0x36, 0x34, 0x10, 0x03, 0x12, 0x0f, 0x0a, 0x0b, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x55, - 0x49, 0x4e, 0x54, 0x36, 0x34, 0x10, 0x04, 0x12, 0x0e, 0x0a, 0x0a, 0x54, 0x59, 0x50, 0x45, 0x5f, - 0x49, 0x4e, 0x54, 0x33, 0x32, 0x10, 0x05, 0x12, 0x10, 0x0a, 0x0c, 0x54, 0x59, 0x50, 0x45, 0x5f, - 0x46, 0x49, 0x58, 0x45, 0x44, 0x36, 0x34, 0x10, 0x06, 0x12, 0x10, 0x0a, 0x0c, 0x54, 0x59, 0x50, - 0x45, 0x5f, 0x46, 0x49, 0x58, 0x45, 0x44, 0x33, 0x32, 0x10, 0x07, 0x12, 0x0d, 0x0a, 0x09, 0x54, - 0x59, 0x50, 0x45, 0x5f, 0x42, 0x4f, 0x4f, 0x4c, 0x10, 0x08, 0x12, 0x0f, 0x0a, 0x0b, 0x54, 0x59, - 0x50, 0x45, 0x5f, 0x53, 0x54, 0x52, 0x49, 0x4e, 0x47, 0x10, 0x09, 0x12, 0x0e, 0x0a, 0x0a, 0x54, - 0x59, 0x50, 0x45, 0x5f, 0x47, 0x52, 0x4f, 0x55, 0x50, 0x10, 0x0a, 0x12, 0x10, 0x0a, 0x0c, 0x54, - 0x59, 0x50, 0x45, 0x5f, 0x4d, 0x45, 0x53, 0x53, 0x41, 0x47, 0x45, 0x10, 0x0b, 0x12, 0x0e, 0x0a, - 0x0a, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x42, 0x59, 0x54, 0x45, 0x53, 0x10, 0x0c, 0x12, 0x0f, 0x0a, - 0x0b, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x55, 0x49, 0x4e, 0x54, 0x33, 0x32, 0x10, 0x0d, 0x12, 0x0d, - 0x0a, 0x09, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x45, 0x4e, 0x55, 0x4d, 0x10, 0x0e, 0x12, 0x11, 0x0a, - 0x0d, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x53, 0x46, 0x49, 0x58, 0x45, 0x44, 0x33, 0x32, 0x10, 0x0f, - 0x12, 0x11, 0x0a, 0x0d, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x53, 0x46, 0x49, 0x58, 0x45, 0x44, 0x36, - 0x34, 0x10, 0x10, 0x12, 0x0f, 0x0a, 0x0b, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x53, 0x49, 0x4e, 0x54, - 0x33, 0x32, 0x10, 0x11, 0x12, 0x0f, 0x0a, 0x0b, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x53, 0x49, 0x4e, - 0x54, 0x36, 0x34, 0x10, 0x12, 0x22, 0x43, 0x0a, 0x05, 0x4c, 0x61, 0x62, 0x65, 0x6c, 0x12, 0x12, - 0x0a, 0x0e, 0x4c, 0x41, 0x42, 0x45, 0x4c, 0x5f, 0x4f, 0x50, 0x54, 0x49, 0x4f, 0x4e, 0x41, 0x4c, - 0x10, 0x01, 0x12, 0x12, 0x0a, 0x0e, 0x4c, 0x41, 0x42, 0x45, 0x4c, 0x5f, 0x52, 0x45, 0x50, 0x45, - 0x41, 0x54, 0x45, 0x44, 0x10, 0x03, 0x12, 0x12, 0x0a, 0x0e, 0x4c, 0x41, 0x42, 0x45, 0x4c, 0x5f, - 0x52, 0x45, 0x51, 0x55, 0x49, 0x52, 0x45, 0x44, 0x10, 0x02, 0x22, 0x63, 0x0a, 0x14, 0x4f, 0x6e, - 0x65, 0x6f, 0x66, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x50, 0x72, 0x6f, - 0x74, 0x6f, 0x12, 0x12, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, - 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x37, 0x0a, 0x07, 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, - 0x73, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1d, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, - 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x4f, 0x6e, 0x65, 0x6f, 0x66, 0x4f, - 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x52, 0x07, 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x22, - 0xe3, 0x02, 0x0a, 0x13, 0x45, 0x6e, 0x75, 0x6d, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, - 0x6f, 0x72, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x12, 0x12, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, - 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x3f, 0x0a, 0x05, 0x76, - 0x61, 0x6c, 0x75, 0x65, 0x18, 0x02, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x29, 0x2e, 0x67, 0x6f, 0x6f, - 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x45, 0x6e, 0x75, - 0x6d, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, - 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x52, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x12, 0x36, 0x0a, 0x07, - 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x18, 0x03, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1c, 0x2e, - 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, - 0x45, 0x6e, 0x75, 0x6d, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x52, 0x07, 0x6f, 0x70, 0x74, - 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x5d, 0x0a, 0x0e, 0x72, 0x65, 0x73, 0x65, 0x72, 0x76, 0x65, 0x64, - 0x5f, 0x72, 0x61, 0x6e, 0x67, 0x65, 0x18, 0x04, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x36, 0x2e, 0x67, - 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x45, - 0x6e, 0x75, 0x6d, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x50, 0x72, 0x6f, - 0x74, 0x6f, 0x2e, 0x45, 0x6e, 0x75, 0x6d, 0x52, 0x65, 0x73, 0x65, 0x72, 0x76, 0x65, 0x64, 0x52, - 0x61, 0x6e, 0x67, 0x65, 0x52, 0x0d, 0x72, 0x65, 0x73, 0x65, 0x72, 0x76, 0x65, 0x64, 0x52, 0x61, - 0x6e, 0x67, 0x65, 0x12, 0x23, 0x0a, 0x0d, 0x72, 0x65, 0x73, 0x65, 0x72, 0x76, 0x65, 0x64, 0x5f, - 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x05, 0x20, 0x03, 0x28, 0x09, 0x52, 0x0c, 0x72, 0x65, 0x73, 0x65, - 0x72, 0x76, 0x65, 0x64, 0x4e, 0x61, 0x6d, 0x65, 0x1a, 0x3b, 0x0a, 0x11, 0x45, 0x6e, 0x75, 0x6d, - 0x52, 0x65, 0x73, 0x65, 0x72, 0x76, 0x65, 0x64, 0x52, 0x61, 0x6e, 0x67, 0x65, 0x12, 0x14, 0x0a, - 0x05, 0x73, 0x74, 0x61, 0x72, 0x74, 0x18, 0x01, 0x20, 0x01, 0x28, 0x05, 0x52, 0x05, 0x73, 0x74, - 0x61, 0x72, 0x74, 0x12, 0x10, 0x0a, 0x03, 0x65, 0x6e, 0x64, 0x18, 0x02, 0x20, 0x01, 0x28, 0x05, - 0x52, 0x03, 0x65, 0x6e, 0x64, 0x22, 0x83, 0x01, 0x0a, 0x18, 0x45, 0x6e, 0x75, 0x6d, 0x56, 0x61, - 0x6c, 0x75, 0x65, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x50, 0x72, 0x6f, - 0x74, 0x6f, 0x12, 0x12, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, - 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x16, 0x0a, 0x06, 0x6e, 0x75, 0x6d, 0x62, 0x65, 0x72, - 0x18, 0x02, 0x20, 0x01, 0x28, 0x05, 0x52, 0x06, 0x6e, 0x75, 0x6d, 0x62, 0x65, 0x72, 0x12, 0x3b, - 0x0a, 0x07, 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x18, 0x03, 0x20, 0x01, 0x28, 0x0b, 0x32, - 0x21, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, - 0x66, 0x2e, 0x45, 0x6e, 0x75, 0x6d, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x4f, 0x70, 0x74, 0x69, 0x6f, - 0x6e, 0x73, 0x52, 0x07, 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x22, 0xa7, 0x01, 0x0a, 0x16, - 0x53, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, - 0x72, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x12, 0x12, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x01, - 0x20, 0x01, 0x28, 0x09, 0x52, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x3e, 0x0a, 0x06, 0x6d, 0x65, - 0x74, 0x68, 0x6f, 0x64, 0x18, 0x02, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x26, 0x2e, 0x67, 0x6f, 0x6f, - 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x4d, 0x65, 0x74, - 0x68, 0x6f, 0x64, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x50, 0x72, 0x6f, - 0x74, 0x6f, 0x52, 0x06, 0x6d, 0x65, 0x74, 0x68, 0x6f, 0x64, 0x12, 0x39, 0x0a, 0x07, 0x6f, 0x70, - 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x18, 0x03, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1f, 0x2e, 0x67, 0x6f, - 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x53, 0x65, - 0x72, 0x76, 0x69, 0x63, 0x65, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x52, 0x07, 0x6f, 0x70, - 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x22, 0x89, 0x02, 0x0a, 0x15, 0x4d, 0x65, 0x74, 0x68, 0x6f, 0x64, - 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x12, - 0x12, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x04, 0x6e, - 0x61, 0x6d, 0x65, 0x12, 0x1d, 0x0a, 0x0a, 0x69, 0x6e, 0x70, 0x75, 0x74, 0x5f, 0x74, 0x79, 0x70, - 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x09, 0x69, 0x6e, 0x70, 0x75, 0x74, 0x54, 0x79, - 0x70, 0x65, 0x12, 0x1f, 0x0a, 0x0b, 0x6f, 0x75, 0x74, 0x70, 0x75, 0x74, 0x5f, 0x74, 0x79, 0x70, - 0x65, 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0a, 0x6f, 0x75, 0x74, 0x70, 0x75, 0x74, 0x54, - 0x79, 0x70, 0x65, 0x12, 0x38, 0x0a, 0x07, 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x18, 0x04, - 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1e, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, - 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x4d, 0x65, 0x74, 0x68, 0x6f, 0x64, 0x4f, 0x70, 0x74, - 0x69, 0x6f, 0x6e, 0x73, 0x52, 0x07, 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x30, 0x0a, - 0x10, 0x63, 0x6c, 0x69, 0x65, 0x6e, 0x74, 0x5f, 0x73, 0x74, 0x72, 0x65, 0x61, 0x6d, 0x69, 0x6e, - 0x67, 0x18, 0x05, 0x20, 0x01, 0x28, 0x08, 0x3a, 0x05, 0x66, 0x61, 0x6c, 0x73, 0x65, 0x52, 0x0f, - 0x63, 0x6c, 0x69, 0x65, 0x6e, 0x74, 0x53, 0x74, 0x72, 0x65, 0x61, 0x6d, 0x69, 0x6e, 0x67, 0x12, - 0x30, 0x0a, 0x10, 0x73, 0x65, 0x72, 0x76, 0x65, 0x72, 0x5f, 0x73, 0x74, 0x72, 0x65, 0x61, 0x6d, - 0x69, 0x6e, 0x67, 0x18, 0x06, 0x20, 0x01, 0x28, 0x08, 0x3a, 0x05, 0x66, 0x61, 0x6c, 0x73, 0x65, - 0x52, 0x0f, 0x73, 0x65, 0x72, 0x76, 0x65, 0x72, 0x53, 0x74, 0x72, 0x65, 0x61, 0x6d, 0x69, 0x6e, - 0x67, 0x22, 0xad, 0x09, 0x0a, 0x0b, 0x46, 0x69, 0x6c, 0x65, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, - 0x73, 0x12, 0x21, 0x0a, 0x0c, 0x6a, 0x61, 0x76, 0x61, 0x5f, 0x70, 0x61, 0x63, 0x6b, 0x61, 0x67, - 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0b, 0x6a, 0x61, 0x76, 0x61, 0x50, 0x61, 0x63, - 0x6b, 0x61, 0x67, 0x65, 0x12, 0x30, 0x0a, 0x14, 0x6a, 0x61, 0x76, 0x61, 0x5f, 0x6f, 0x75, 0x74, - 0x65, 0x72, 0x5f, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x08, 0x20, 0x01, - 0x28, 0x09, 0x52, 0x12, 0x6a, 0x61, 0x76, 0x61, 0x4f, 0x75, 0x74, 0x65, 0x72, 0x43, 0x6c, 0x61, - 0x73, 0x73, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x35, 0x0a, 0x13, 0x6a, 0x61, 0x76, 0x61, 0x5f, 0x6d, - 0x75, 0x6c, 0x74, 0x69, 0x70, 0x6c, 0x65, 0x5f, 0x66, 0x69, 0x6c, 0x65, 0x73, 0x18, 0x0a, 0x20, - 0x01, 0x28, 0x08, 0x3a, 0x05, 0x66, 0x61, 0x6c, 0x73, 0x65, 0x52, 0x11, 0x6a, 0x61, 0x76, 0x61, - 0x4d, 0x75, 0x6c, 0x74, 0x69, 0x70, 0x6c, 0x65, 0x46, 0x69, 0x6c, 0x65, 0x73, 0x12, 0x44, 0x0a, - 0x1d, 0x6a, 0x61, 0x76, 0x61, 0x5f, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x65, 0x5f, 0x65, - 0x71, 0x75, 0x61, 0x6c, 0x73, 0x5f, 0x61, 0x6e, 0x64, 0x5f, 0x68, 0x61, 0x73, 0x68, 0x18, 0x14, - 0x20, 0x01, 0x28, 0x08, 0x42, 0x02, 0x18, 0x01, 0x52, 0x19, 0x6a, 0x61, 0x76, 0x61, 0x47, 0x65, - 0x6e, 0x65, 0x72, 0x61, 0x74, 0x65, 0x45, 0x71, 0x75, 0x61, 0x6c, 0x73, 0x41, 0x6e, 0x64, 0x48, - 0x61, 0x73, 0x68, 0x12, 0x3a, 0x0a, 0x16, 0x6a, 0x61, 0x76, 0x61, 0x5f, 0x73, 0x74, 0x72, 0x69, - 0x6e, 0x67, 0x5f, 0x63, 0x68, 0x65, 0x63, 0x6b, 0x5f, 0x75, 0x74, 0x66, 0x38, 0x18, 0x1b, 0x20, - 0x01, 0x28, 0x08, 0x3a, 0x05, 0x66, 0x61, 0x6c, 0x73, 0x65, 0x52, 0x13, 0x6a, 0x61, 0x76, 0x61, - 0x53, 0x74, 0x72, 0x69, 0x6e, 0x67, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x55, 0x74, 0x66, 0x38, 0x12, - 0x53, 0x0a, 0x0c, 0x6f, 0x70, 0x74, 0x69, 0x6d, 0x69, 0x7a, 0x65, 0x5f, 0x66, 0x6f, 0x72, 0x18, - 0x09, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x29, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, - 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x69, 0x6c, 0x65, 0x4f, 0x70, 0x74, 0x69, - 0x6f, 0x6e, 0x73, 0x2e, 0x4f, 0x70, 0x74, 0x69, 0x6d, 0x69, 0x7a, 0x65, 0x4d, 0x6f, 0x64, 0x65, - 0x3a, 0x05, 0x53, 0x50, 0x45, 0x45, 0x44, 0x52, 0x0b, 0x6f, 0x70, 0x74, 0x69, 0x6d, 0x69, 0x7a, - 0x65, 0x46, 0x6f, 0x72, 0x12, 0x1d, 0x0a, 0x0a, 0x67, 0x6f, 0x5f, 0x70, 0x61, 0x63, 0x6b, 0x61, - 0x67, 0x65, 0x18, 0x0b, 0x20, 0x01, 0x28, 0x09, 0x52, 0x09, 0x67, 0x6f, 0x50, 0x61, 0x63, 0x6b, - 0x61, 0x67, 0x65, 0x12, 0x35, 0x0a, 0x13, 0x63, 0x63, 0x5f, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x69, - 0x63, 0x5f, 0x73, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x73, 0x18, 0x10, 0x20, 0x01, 0x28, 0x08, - 0x3a, 0x05, 0x66, 0x61, 0x6c, 0x73, 0x65, 0x52, 0x11, 0x63, 0x63, 0x47, 0x65, 0x6e, 0x65, 0x72, - 0x69, 0x63, 0x53, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x73, 0x12, 0x39, 0x0a, 0x15, 0x6a, 0x61, - 0x76, 0x61, 0x5f, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x69, 0x63, 0x5f, 0x73, 0x65, 0x72, 0x76, 0x69, - 0x63, 0x65, 0x73, 0x18, 0x11, 0x20, 0x01, 0x28, 0x08, 0x3a, 0x05, 0x66, 0x61, 0x6c, 0x73, 0x65, - 0x52, 0x13, 0x6a, 0x61, 0x76, 0x61, 0x47, 0x65, 0x6e, 0x65, 0x72, 0x69, 0x63, 0x53, 0x65, 0x72, - 0x76, 0x69, 0x63, 0x65, 0x73, 0x12, 0x35, 0x0a, 0x13, 0x70, 0x79, 0x5f, 0x67, 0x65, 0x6e, 0x65, - 0x72, 0x69, 0x63, 0x5f, 0x73, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x73, 0x18, 0x12, 0x20, 0x01, - 0x28, 0x08, 0x3a, 0x05, 0x66, 0x61, 0x6c, 0x73, 0x65, 0x52, 0x11, 0x70, 0x79, 0x47, 0x65, 0x6e, - 0x65, 0x72, 0x69, 0x63, 0x53, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x73, 0x12, 0x25, 0x0a, 0x0a, - 0x64, 0x65, 0x70, 0x72, 0x65, 0x63, 0x61, 0x74, 0x65, 0x64, 0x18, 0x17, 0x20, 0x01, 0x28, 0x08, - 0x3a, 0x05, 0x66, 0x61, 0x6c, 0x73, 0x65, 0x52, 0x0a, 0x64, 0x65, 0x70, 0x72, 0x65, 0x63, 0x61, - 0x74, 0x65, 0x64, 0x12, 0x2e, 0x0a, 0x10, 0x63, 0x63, 0x5f, 0x65, 0x6e, 0x61, 0x62, 0x6c, 0x65, - 0x5f, 0x61, 0x72, 0x65, 0x6e, 0x61, 0x73, 0x18, 0x1f, 0x20, 0x01, 0x28, 0x08, 0x3a, 0x04, 0x74, - 0x72, 0x75, 0x65, 0x52, 0x0e, 0x63, 0x63, 0x45, 0x6e, 0x61, 0x62, 0x6c, 0x65, 0x41, 0x72, 0x65, - 0x6e, 0x61, 0x73, 0x12, 0x2a, 0x0a, 0x11, 0x6f, 0x62, 0x6a, 0x63, 0x5f, 0x63, 0x6c, 0x61, 0x73, - 0x73, 0x5f, 0x70, 0x72, 0x65, 0x66, 0x69, 0x78, 0x18, 0x24, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0f, - 0x6f, 0x62, 0x6a, 0x63, 0x43, 0x6c, 0x61, 0x73, 0x73, 0x50, 0x72, 0x65, 0x66, 0x69, 0x78, 0x12, - 0x29, 0x0a, 0x10, 0x63, 0x73, 0x68, 0x61, 0x72, 0x70, 0x5f, 0x6e, 0x61, 0x6d, 0x65, 0x73, 0x70, - 0x61, 0x63, 0x65, 0x18, 0x25, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0f, 0x63, 0x73, 0x68, 0x61, 0x72, - 0x70, 0x4e, 0x61, 0x6d, 0x65, 0x73, 0x70, 0x61, 0x63, 0x65, 0x12, 0x21, 0x0a, 0x0c, 0x73, 0x77, - 0x69, 0x66, 0x74, 0x5f, 0x70, 0x72, 0x65, 0x66, 0x69, 0x78, 0x18, 0x27, 0x20, 0x01, 0x28, 0x09, - 0x52, 0x0b, 0x73, 0x77, 0x69, 0x66, 0x74, 0x50, 0x72, 0x65, 0x66, 0x69, 0x78, 0x12, 0x28, 0x0a, - 0x10, 0x70, 0x68, 0x70, 0x5f, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x5f, 0x70, 0x72, 0x65, 0x66, 0x69, - 0x78, 0x18, 0x28, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0e, 0x70, 0x68, 0x70, 0x43, 0x6c, 0x61, 0x73, - 0x73, 0x50, 0x72, 0x65, 0x66, 0x69, 0x78, 0x12, 0x23, 0x0a, 0x0d, 0x70, 0x68, 0x70, 0x5f, 0x6e, - 0x61, 0x6d, 0x65, 0x73, 0x70, 0x61, 0x63, 0x65, 0x18, 0x29, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0c, - 0x70, 0x68, 0x70, 0x4e, 0x61, 0x6d, 0x65, 0x73, 0x70, 0x61, 0x63, 0x65, 0x12, 0x34, 0x0a, 0x16, - 0x70, 0x68, 0x70, 0x5f, 0x6d, 0x65, 0x74, 0x61, 0x64, 0x61, 0x74, 0x61, 0x5f, 0x6e, 0x61, 0x6d, - 0x65, 0x73, 0x70, 0x61, 0x63, 0x65, 0x18, 0x2c, 0x20, 0x01, 0x28, 0x09, 0x52, 0x14, 0x70, 0x68, - 0x70, 0x4d, 0x65, 0x74, 0x61, 0x64, 0x61, 0x74, 0x61, 0x4e, 0x61, 0x6d, 0x65, 0x73, 0x70, 0x61, - 0x63, 0x65, 0x12, 0x21, 0x0a, 0x0c, 0x72, 0x75, 0x62, 0x79, 0x5f, 0x70, 0x61, 0x63, 0x6b, 0x61, - 0x67, 0x65, 0x18, 0x2d, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0b, 0x72, 0x75, 0x62, 0x79, 0x50, 0x61, - 0x63, 0x6b, 0x61, 0x67, 0x65, 0x12, 0x37, 0x0a, 0x08, 0x66, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, - 0x73, 0x18, 0x32, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1b, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, - 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x65, 0x61, 0x74, 0x75, 0x72, - 0x65, 0x53, 0x65, 0x74, 0x52, 0x08, 0x66, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x73, 0x12, 0x58, - 0x0a, 0x14, 0x75, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, 0x64, 0x5f, - 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0xe7, 0x07, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x24, 0x2e, - 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, - 0x55, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, 0x64, 0x4f, 0x70, 0x74, - 0x69, 0x6f, 0x6e, 0x52, 0x13, 0x75, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, - 0x65, 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x22, 0x3a, 0x0a, 0x0c, 0x4f, 0x70, 0x74, 0x69, - 0x6d, 0x69, 0x7a, 0x65, 0x4d, 0x6f, 0x64, 0x65, 0x12, 0x09, 0x0a, 0x05, 0x53, 0x50, 0x45, 0x45, - 0x44, 0x10, 0x01, 0x12, 0x0d, 0x0a, 0x09, 0x43, 0x4f, 0x44, 0x45, 0x5f, 0x53, 0x49, 0x5a, 0x45, - 0x10, 0x02, 0x12, 0x10, 0x0a, 0x0c, 0x4c, 0x49, 0x54, 0x45, 0x5f, 0x52, 0x55, 0x4e, 0x54, 0x49, - 0x4d, 0x45, 0x10, 0x03, 0x2a, 0x09, 0x08, 0xe8, 0x07, 0x10, 0x80, 0x80, 0x80, 0x80, 0x02, 0x4a, - 0x04, 0x08, 0x2a, 0x10, 0x2b, 0x4a, 0x04, 0x08, 0x26, 0x10, 0x27, 0x52, 0x14, 0x70, 0x68, 0x70, - 0x5f, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x69, 0x63, 0x5f, 0x73, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, - 0x73, 0x22, 0xf4, 0x03, 0x0a, 0x0e, 0x4d, 0x65, 0x73, 0x73, 0x61, 0x67, 0x65, 0x4f, 0x70, 0x74, - 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x3c, 0x0a, 0x17, 0x6d, 0x65, 0x73, 0x73, 0x61, 0x67, 0x65, 0x5f, - 0x73, 0x65, 0x74, 0x5f, 0x77, 0x69, 0x72, 0x65, 0x5f, 0x66, 0x6f, 0x72, 0x6d, 0x61, 0x74, 0x18, - 0x01, 0x20, 0x01, 0x28, 0x08, 0x3a, 0x05, 0x66, 0x61, 0x6c, 0x73, 0x65, 0x52, 0x14, 0x6d, 0x65, - 0x73, 0x73, 0x61, 0x67, 0x65, 0x53, 0x65, 0x74, 0x57, 0x69, 0x72, 0x65, 0x46, 0x6f, 0x72, 0x6d, - 0x61, 0x74, 0x12, 0x4c, 0x0a, 0x1f, 0x6e, 0x6f, 0x5f, 0x73, 0x74, 0x61, 0x6e, 0x64, 0x61, 0x72, - 0x64, 0x5f, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x5f, 0x61, 0x63, 0x63, - 0x65, 0x73, 0x73, 0x6f, 0x72, 0x18, 0x02, 0x20, 0x01, 0x28, 0x08, 0x3a, 0x05, 0x66, 0x61, 0x6c, - 0x73, 0x65, 0x52, 0x1c, 0x6e, 0x6f, 0x53, 0x74, 0x61, 0x6e, 0x64, 0x61, 0x72, 0x64, 0x44, 0x65, - 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x41, 0x63, 0x63, 0x65, 0x73, 0x73, 0x6f, 0x72, - 0x12, 0x25, 0x0a, 0x0a, 0x64, 0x65, 0x70, 0x72, 0x65, 0x63, 0x61, 0x74, 0x65, 0x64, 0x18, 0x03, - 0x20, 0x01, 0x28, 0x08, 0x3a, 0x05, 0x66, 0x61, 0x6c, 0x73, 0x65, 0x52, 0x0a, 0x64, 0x65, 0x70, - 0x72, 0x65, 0x63, 0x61, 0x74, 0x65, 0x64, 0x12, 0x1b, 0x0a, 0x09, 0x6d, 0x61, 0x70, 0x5f, 0x65, - 0x6e, 0x74, 0x72, 0x79, 0x18, 0x07, 0x20, 0x01, 0x28, 0x08, 0x52, 0x08, 0x6d, 0x61, 0x70, 0x45, - 0x6e, 0x74, 0x72, 0x79, 0x12, 0x56, 0x0a, 0x26, 0x64, 0x65, 0x70, 0x72, 0x65, 0x63, 0x61, 0x74, - 0x65, 0x64, 0x5f, 0x6c, 0x65, 0x67, 0x61, 0x63, 0x79, 0x5f, 0x6a, 0x73, 0x6f, 0x6e, 0x5f, 0x66, - 0x69, 0x65, 0x6c, 0x64, 0x5f, 0x63, 0x6f, 0x6e, 0x66, 0x6c, 0x69, 0x63, 0x74, 0x73, 0x18, 0x0b, - 0x20, 0x01, 0x28, 0x08, 0x42, 0x02, 0x18, 0x01, 0x52, 0x22, 0x64, 0x65, 0x70, 0x72, 0x65, 0x63, - 0x61, 0x74, 0x65, 0x64, 0x4c, 0x65, 0x67, 0x61, 0x63, 0x79, 0x4a, 0x73, 0x6f, 0x6e, 0x46, 0x69, - 0x65, 0x6c, 0x64, 0x43, 0x6f, 0x6e, 0x66, 0x6c, 0x69, 0x63, 0x74, 0x73, 0x12, 0x37, 0x0a, 0x08, - 0x66, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x73, 0x18, 0x0c, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1b, - 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, - 0x2e, 0x46, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x53, 0x65, 0x74, 0x52, 0x08, 0x66, 0x65, 0x61, - 0x74, 0x75, 0x72, 0x65, 0x73, 0x12, 0x58, 0x0a, 0x14, 0x75, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, - 0x70, 0x72, 0x65, 0x74, 0x65, 0x64, 0x5f, 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0xe7, 0x07, - 0x20, 0x03, 0x28, 0x0b, 0x32, 0x24, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, - 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x55, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, - 0x65, 0x74, 0x65, 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x13, 0x75, 0x6e, 0x69, 0x6e, - 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x2a, - 0x09, 0x08, 0xe8, 0x07, 0x10, 0x80, 0x80, 0x80, 0x80, 0x02, 0x4a, 0x04, 0x08, 0x04, 0x10, 0x05, - 0x4a, 0x04, 0x08, 0x05, 0x10, 0x06, 0x4a, 0x04, 0x08, 0x06, 0x10, 0x07, 0x4a, 0x04, 0x08, 0x08, - 0x10, 0x09, 0x4a, 0x04, 0x08, 0x09, 0x10, 0x0a, 0x22, 0x9d, 0x0d, 0x0a, 0x0c, 0x46, 0x69, 0x65, - 0x6c, 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x41, 0x0a, 0x05, 0x63, 0x74, 0x79, - 0x70, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x23, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, - 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x69, 0x65, 0x6c, 0x64, - 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x2e, 0x43, 0x54, 0x79, 0x70, 0x65, 0x3a, 0x06, 0x53, - 0x54, 0x52, 0x49, 0x4e, 0x47, 0x52, 0x05, 0x63, 0x74, 0x79, 0x70, 0x65, 0x12, 0x16, 0x0a, 0x06, - 0x70, 0x61, 0x63, 0x6b, 0x65, 0x64, 0x18, 0x02, 0x20, 0x01, 0x28, 0x08, 0x52, 0x06, 0x70, 0x61, - 0x63, 0x6b, 0x65, 0x64, 0x12, 0x47, 0x0a, 0x06, 0x6a, 0x73, 0x74, 0x79, 0x70, 0x65, 0x18, 0x06, - 0x20, 0x01, 0x28, 0x0e, 0x32, 0x24, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, - 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x69, 0x65, 0x6c, 0x64, 0x4f, 0x70, 0x74, 0x69, - 0x6f, 0x6e, 0x73, 0x2e, 0x4a, 0x53, 0x54, 0x79, 0x70, 0x65, 0x3a, 0x09, 0x4a, 0x53, 0x5f, 0x4e, - 0x4f, 0x52, 0x4d, 0x41, 0x4c, 0x52, 0x06, 0x6a, 0x73, 0x74, 0x79, 0x70, 0x65, 0x12, 0x19, 0x0a, - 0x04, 0x6c, 0x61, 0x7a, 0x79, 0x18, 0x05, 0x20, 0x01, 0x28, 0x08, 0x3a, 0x05, 0x66, 0x61, 0x6c, - 0x73, 0x65, 0x52, 0x04, 0x6c, 0x61, 0x7a, 0x79, 0x12, 0x2e, 0x0a, 0x0f, 0x75, 0x6e, 0x76, 0x65, - 0x72, 0x69, 0x66, 0x69, 0x65, 0x64, 0x5f, 0x6c, 0x61, 0x7a, 0x79, 0x18, 0x0f, 0x20, 0x01, 0x28, - 0x08, 0x3a, 0x05, 0x66, 0x61, 0x6c, 0x73, 0x65, 0x52, 0x0e, 0x75, 0x6e, 0x76, 0x65, 0x72, 0x69, - 0x66, 0x69, 0x65, 0x64, 0x4c, 0x61, 0x7a, 0x79, 0x12, 0x25, 0x0a, 0x0a, 0x64, 0x65, 0x70, 0x72, - 0x65, 0x63, 0x61, 0x74, 0x65, 0x64, 0x18, 0x03, 0x20, 0x01, 0x28, 0x08, 0x3a, 0x05, 0x66, 0x61, - 0x6c, 0x73, 0x65, 0x52, 0x0a, 0x64, 0x65, 0x70, 0x72, 0x65, 0x63, 0x61, 0x74, 0x65, 0x64, 0x12, - 0x19, 0x0a, 0x04, 0x77, 0x65, 0x61, 0x6b, 0x18, 0x0a, 0x20, 0x01, 0x28, 0x08, 0x3a, 0x05, 0x66, - 0x61, 0x6c, 0x73, 0x65, 0x52, 0x04, 0x77, 0x65, 0x61, 0x6b, 0x12, 0x28, 0x0a, 0x0c, 0x64, 0x65, - 0x62, 0x75, 0x67, 0x5f, 0x72, 0x65, 0x64, 0x61, 0x63, 0x74, 0x18, 0x10, 0x20, 0x01, 0x28, 0x08, - 0x3a, 0x05, 0x66, 0x61, 0x6c, 0x73, 0x65, 0x52, 0x0b, 0x64, 0x65, 0x62, 0x75, 0x67, 0x52, 0x65, - 0x64, 0x61, 0x63, 0x74, 0x12, 0x4b, 0x0a, 0x09, 0x72, 0x65, 0x74, 0x65, 0x6e, 0x74, 0x69, 0x6f, - 0x6e, 0x18, 0x11, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x2d, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, - 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x69, 0x65, 0x6c, 0x64, 0x4f, - 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x2e, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x65, 0x74, - 0x65, 0x6e, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x09, 0x72, 0x65, 0x74, 0x65, 0x6e, 0x74, 0x69, 0x6f, - 0x6e, 0x12, 0x48, 0x0a, 0x07, 0x74, 0x61, 0x72, 0x67, 0x65, 0x74, 0x73, 0x18, 0x13, 0x20, 0x03, - 0x28, 0x0e, 0x32, 0x2e, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, - 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x69, 0x65, 0x6c, 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, - 0x73, 0x2e, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x54, 0x61, 0x72, 0x67, 0x65, 0x74, 0x54, 0x79, - 0x70, 0x65, 0x52, 0x07, 0x74, 0x61, 0x72, 0x67, 0x65, 0x74, 0x73, 0x12, 0x57, 0x0a, 0x10, 0x65, - 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x64, 0x65, 0x66, 0x61, 0x75, 0x6c, 0x74, 0x73, 0x18, - 0x14, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x2c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, - 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x69, 0x65, 0x6c, 0x64, 0x4f, 0x70, 0x74, - 0x69, 0x6f, 0x6e, 0x73, 0x2e, 0x45, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x44, 0x65, 0x66, 0x61, - 0x75, 0x6c, 0x74, 0x52, 0x0f, 0x65, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x44, 0x65, 0x66, 0x61, - 0x75, 0x6c, 0x74, 0x73, 0x12, 0x37, 0x0a, 0x08, 0x66, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x73, - 0x18, 0x15, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1b, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, - 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, - 0x53, 0x65, 0x74, 0x52, 0x08, 0x66, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x73, 0x12, 0x55, 0x0a, - 0x0f, 0x66, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x5f, 0x73, 0x75, 0x70, 0x70, 0x6f, 0x72, 0x74, - 0x18, 0x16, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x2c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, - 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x69, 0x65, 0x6c, 0x64, 0x4f, 0x70, - 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x2e, 0x46, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x53, 0x75, 0x70, - 0x70, 0x6f, 0x72, 0x74, 0x52, 0x0e, 0x66, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x53, 0x75, 0x70, - 0x70, 0x6f, 0x72, 0x74, 0x12, 0x58, 0x0a, 0x14, 0x75, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, - 0x72, 0x65, 0x74, 0x65, 0x64, 0x5f, 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0xe7, 0x07, 0x20, - 0x03, 0x28, 0x0b, 0x32, 0x24, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, - 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x55, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, - 0x74, 0x65, 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x13, 0x75, 0x6e, 0x69, 0x6e, 0x74, - 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x1a, 0x5a, - 0x0a, 0x0e, 0x45, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x44, 0x65, 0x66, 0x61, 0x75, 0x6c, 0x74, - 0x12, 0x32, 0x0a, 0x07, 0x65, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x03, 0x20, 0x01, 0x28, - 0x0e, 0x32, 0x18, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, - 0x62, 0x75, 0x66, 0x2e, 0x45, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x07, 0x65, 0x64, 0x69, - 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x14, 0x0a, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x02, 0x20, - 0x01, 0x28, 0x09, 0x52, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x1a, 0x96, 0x02, 0x0a, 0x0e, 0x46, - 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x53, 0x75, 0x70, 0x70, 0x6f, 0x72, 0x74, 0x12, 0x47, 0x0a, - 0x12, 0x65, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x69, 0x6e, 0x74, 0x72, 0x6f, 0x64, 0x75, - 0x63, 0x65, 0x64, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x18, 0x2e, 0x67, 0x6f, 0x6f, 0x67, - 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x45, 0x64, 0x69, 0x74, - 0x69, 0x6f, 0x6e, 0x52, 0x11, 0x65, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x49, 0x6e, 0x74, 0x72, - 0x6f, 0x64, 0x75, 0x63, 0x65, 0x64, 0x12, 0x47, 0x0a, 0x12, 0x65, 0x64, 0x69, 0x74, 0x69, 0x6f, - 0x6e, 0x5f, 0x64, 0x65, 0x70, 0x72, 0x65, 0x63, 0x61, 0x74, 0x65, 0x64, 0x18, 0x02, 0x20, 0x01, - 0x28, 0x0e, 0x32, 0x18, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, - 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x45, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x11, 0x65, 0x64, - 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x44, 0x65, 0x70, 0x72, 0x65, 0x63, 0x61, 0x74, 0x65, 0x64, 0x12, - 0x2f, 0x0a, 0x13, 0x64, 0x65, 0x70, 0x72, 0x65, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x77, - 0x61, 0x72, 0x6e, 0x69, 0x6e, 0x67, 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, 0x52, 0x12, 0x64, 0x65, - 0x70, 0x72, 0x65, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x57, 0x61, 0x72, 0x6e, 0x69, 0x6e, 0x67, - 0x12, 0x41, 0x0a, 0x0f, 0x65, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x72, 0x65, 0x6d, 0x6f, - 0x76, 0x65, 0x64, 0x18, 0x04, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x18, 0x2e, 0x67, 0x6f, 0x6f, 0x67, - 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x45, 0x64, 0x69, 0x74, - 0x69, 0x6f, 0x6e, 0x52, 0x0e, 0x65, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x65, 0x6d, 0x6f, - 0x76, 0x65, 0x64, 0x22, 0x2f, 0x0a, 0x05, 0x43, 0x54, 0x79, 0x70, 0x65, 0x12, 0x0a, 0x0a, 0x06, - 0x53, 0x54, 0x52, 0x49, 0x4e, 0x47, 0x10, 0x00, 0x12, 0x08, 0x0a, 0x04, 0x43, 0x4f, 0x52, 0x44, - 0x10, 0x01, 0x12, 0x10, 0x0a, 0x0c, 0x53, 0x54, 0x52, 0x49, 0x4e, 0x47, 0x5f, 0x50, 0x49, 0x45, - 0x43, 0x45, 0x10, 0x02, 0x22, 0x35, 0x0a, 0x06, 0x4a, 0x53, 0x54, 0x79, 0x70, 0x65, 0x12, 0x0d, - 0x0a, 0x09, 0x4a, 0x53, 0x5f, 0x4e, 0x4f, 0x52, 0x4d, 0x41, 0x4c, 0x10, 0x00, 0x12, 0x0d, 0x0a, - 0x09, 0x4a, 0x53, 0x5f, 0x53, 0x54, 0x52, 0x49, 0x4e, 0x47, 0x10, 0x01, 0x12, 0x0d, 0x0a, 0x09, - 0x4a, 0x53, 0x5f, 0x4e, 0x55, 0x4d, 0x42, 0x45, 0x52, 0x10, 0x02, 0x22, 0x55, 0x0a, 0x0f, 0x4f, - 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x65, 0x74, 0x65, 0x6e, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x15, - 0x0a, 0x11, 0x52, 0x45, 0x54, 0x45, 0x4e, 0x54, 0x49, 0x4f, 0x4e, 0x5f, 0x55, 0x4e, 0x4b, 0x4e, - 0x4f, 0x57, 0x4e, 0x10, 0x00, 0x12, 0x15, 0x0a, 0x11, 0x52, 0x45, 0x54, 0x45, 0x4e, 0x54, 0x49, - 0x4f, 0x4e, 0x5f, 0x52, 0x55, 0x4e, 0x54, 0x49, 0x4d, 0x45, 0x10, 0x01, 0x12, 0x14, 0x0a, 0x10, - 0x52, 0x45, 0x54, 0x45, 0x4e, 0x54, 0x49, 0x4f, 0x4e, 0x5f, 0x53, 0x4f, 0x55, 0x52, 0x43, 0x45, - 0x10, 0x02, 0x22, 0x8c, 0x02, 0x0a, 0x10, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x54, 0x61, 0x72, - 0x67, 0x65, 0x74, 0x54, 0x79, 0x70, 0x65, 0x12, 0x17, 0x0a, 0x13, 0x54, 0x41, 0x52, 0x47, 0x45, - 0x54, 0x5f, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x55, 0x4e, 0x4b, 0x4e, 0x4f, 0x57, 0x4e, 0x10, 0x00, - 0x12, 0x14, 0x0a, 0x10, 0x54, 0x41, 0x52, 0x47, 0x45, 0x54, 0x5f, 0x54, 0x59, 0x50, 0x45, 0x5f, - 0x46, 0x49, 0x4c, 0x45, 0x10, 0x01, 0x12, 0x1f, 0x0a, 0x1b, 0x54, 0x41, 0x52, 0x47, 0x45, 0x54, - 0x5f, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x45, 0x58, 0x54, 0x45, 0x4e, 0x53, 0x49, 0x4f, 0x4e, 0x5f, - 0x52, 0x41, 0x4e, 0x47, 0x45, 0x10, 0x02, 0x12, 0x17, 0x0a, 0x13, 0x54, 0x41, 0x52, 0x47, 0x45, - 0x54, 0x5f, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x4d, 0x45, 0x53, 0x53, 0x41, 0x47, 0x45, 0x10, 0x03, - 0x12, 0x15, 0x0a, 0x11, 0x54, 0x41, 0x52, 0x47, 0x45, 0x54, 0x5f, 0x54, 0x59, 0x50, 0x45, 0x5f, - 0x46, 0x49, 0x45, 0x4c, 0x44, 0x10, 0x04, 0x12, 0x15, 0x0a, 0x11, 0x54, 0x41, 0x52, 0x47, 0x45, - 0x54, 0x5f, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x4f, 0x4e, 0x45, 0x4f, 0x46, 0x10, 0x05, 0x12, 0x14, - 0x0a, 0x10, 0x54, 0x41, 0x52, 0x47, 0x45, 0x54, 0x5f, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x45, 0x4e, - 0x55, 0x4d, 0x10, 0x06, 0x12, 0x1a, 0x0a, 0x16, 0x54, 0x41, 0x52, 0x47, 0x45, 0x54, 0x5f, 0x54, - 0x59, 0x50, 0x45, 0x5f, 0x45, 0x4e, 0x55, 0x4d, 0x5f, 0x45, 0x4e, 0x54, 0x52, 0x59, 0x10, 0x07, - 0x12, 0x17, 0x0a, 0x13, 0x54, 0x41, 0x52, 0x47, 0x45, 0x54, 0x5f, 0x54, 0x59, 0x50, 0x45, 0x5f, - 0x53, 0x45, 0x52, 0x56, 0x49, 0x43, 0x45, 0x10, 0x08, 0x12, 0x16, 0x0a, 0x12, 0x54, 0x41, 0x52, - 0x47, 0x45, 0x54, 0x5f, 0x54, 0x59, 0x50, 0x45, 0x5f, 0x4d, 0x45, 0x54, 0x48, 0x4f, 0x44, 0x10, - 0x09, 0x2a, 0x09, 0x08, 0xe8, 0x07, 0x10, 0x80, 0x80, 0x80, 0x80, 0x02, 0x4a, 0x04, 0x08, 0x04, - 0x10, 0x05, 0x4a, 0x04, 0x08, 0x12, 0x10, 0x13, 0x22, 0xac, 0x01, 0x0a, 0x0c, 0x4f, 0x6e, 0x65, - 0x6f, 0x66, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x37, 0x0a, 0x08, 0x66, 0x65, 0x61, - 0x74, 0x75, 0x72, 0x65, 0x73, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1b, 0x2e, 0x67, 0x6f, - 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x65, - 0x61, 0x74, 0x75, 0x72, 0x65, 0x53, 0x65, 0x74, 0x52, 0x08, 0x66, 0x65, 0x61, 0x74, 0x75, 0x72, - 0x65, 0x73, 0x12, 0x58, 0x0a, 0x14, 0x75, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, - 0x74, 0x65, 0x64, 0x5f, 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0xe7, 0x07, 0x20, 0x03, 0x28, - 0x0b, 0x32, 0x24, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, - 0x62, 0x75, 0x66, 0x2e, 0x55, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, - 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x13, 0x75, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, - 0x70, 0x72, 0x65, 0x74, 0x65, 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x2a, 0x09, 0x08, 0xe8, - 0x07, 0x10, 0x80, 0x80, 0x80, 0x80, 0x02, 0x22, 0xd1, 0x02, 0x0a, 0x0b, 0x45, 0x6e, 0x75, 0x6d, - 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x1f, 0x0a, 0x0b, 0x61, 0x6c, 0x6c, 0x6f, 0x77, - 0x5f, 0x61, 0x6c, 0x69, 0x61, 0x73, 0x18, 0x02, 0x20, 0x01, 0x28, 0x08, 0x52, 0x0a, 0x61, 0x6c, - 0x6c, 0x6f, 0x77, 0x41, 0x6c, 0x69, 0x61, 0x73, 0x12, 0x25, 0x0a, 0x0a, 0x64, 0x65, 0x70, 0x72, - 0x65, 0x63, 0x61, 0x74, 0x65, 0x64, 0x18, 0x03, 0x20, 0x01, 0x28, 0x08, 0x3a, 0x05, 0x66, 0x61, - 0x6c, 0x73, 0x65, 0x52, 0x0a, 0x64, 0x65, 0x70, 0x72, 0x65, 0x63, 0x61, 0x74, 0x65, 0x64, 0x12, - 0x56, 0x0a, 0x26, 0x64, 0x65, 0x70, 0x72, 0x65, 0x63, 0x61, 0x74, 0x65, 0x64, 0x5f, 0x6c, 0x65, - 0x67, 0x61, 0x63, 0x79, 0x5f, 0x6a, 0x73, 0x6f, 0x6e, 0x5f, 0x66, 0x69, 0x65, 0x6c, 0x64, 0x5f, - 0x63, 0x6f, 0x6e, 0x66, 0x6c, 0x69, 0x63, 0x74, 0x73, 0x18, 0x06, 0x20, 0x01, 0x28, 0x08, 0x42, - 0x02, 0x18, 0x01, 0x52, 0x22, 0x64, 0x65, 0x70, 0x72, 0x65, 0x63, 0x61, 0x74, 0x65, 0x64, 0x4c, - 0x65, 0x67, 0x61, 0x63, 0x79, 0x4a, 0x73, 0x6f, 0x6e, 0x46, 0x69, 0x65, 0x6c, 0x64, 0x43, 0x6f, - 0x6e, 0x66, 0x6c, 0x69, 0x63, 0x74, 0x73, 0x12, 0x37, 0x0a, 0x08, 0x66, 0x65, 0x61, 0x74, 0x75, - 0x72, 0x65, 0x73, 0x18, 0x07, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1b, 0x2e, 0x67, 0x6f, 0x6f, 0x67, - 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x65, 0x61, 0x74, - 0x75, 0x72, 0x65, 0x53, 0x65, 0x74, 0x52, 0x08, 0x66, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x73, - 0x12, 0x58, 0x0a, 0x14, 0x75, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, - 0x64, 0x5f, 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0xe7, 0x07, 0x20, 0x03, 0x28, 0x0b, 0x32, - 0x24, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, - 0x66, 0x2e, 0x55, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, 0x64, 0x4f, - 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x13, 0x75, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, - 0x65, 0x74, 0x65, 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x2a, 0x09, 0x08, 0xe8, 0x07, 0x10, - 0x80, 0x80, 0x80, 0x80, 0x02, 0x4a, 0x04, 0x08, 0x05, 0x10, 0x06, 0x22, 0xd8, 0x02, 0x0a, 0x10, - 0x45, 0x6e, 0x75, 0x6d, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, - 0x12, 0x25, 0x0a, 0x0a, 0x64, 0x65, 0x70, 0x72, 0x65, 0x63, 0x61, 0x74, 0x65, 0x64, 0x18, 0x01, - 0x20, 0x01, 0x28, 0x08, 0x3a, 0x05, 0x66, 0x61, 0x6c, 0x73, 0x65, 0x52, 0x0a, 0x64, 0x65, 0x70, - 0x72, 0x65, 0x63, 0x61, 0x74, 0x65, 0x64, 0x12, 0x37, 0x0a, 0x08, 0x66, 0x65, 0x61, 0x74, 0x75, - 0x72, 0x65, 0x73, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1b, 0x2e, 0x67, 0x6f, 0x6f, 0x67, - 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x65, 0x61, 0x74, - 0x75, 0x72, 0x65, 0x53, 0x65, 0x74, 0x52, 0x08, 0x66, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x73, - 0x12, 0x28, 0x0a, 0x0c, 0x64, 0x65, 0x62, 0x75, 0x67, 0x5f, 0x72, 0x65, 0x64, 0x61, 0x63, 0x74, - 0x18, 0x03, 0x20, 0x01, 0x28, 0x08, 0x3a, 0x05, 0x66, 0x61, 0x6c, 0x73, 0x65, 0x52, 0x0b, 0x64, - 0x65, 0x62, 0x75, 0x67, 0x52, 0x65, 0x64, 0x61, 0x63, 0x74, 0x12, 0x55, 0x0a, 0x0f, 0x66, 0x65, - 0x61, 0x74, 0x75, 0x72, 0x65, 0x5f, 0x73, 0x75, 0x70, 0x70, 0x6f, 0x72, 0x74, 0x18, 0x04, 0x20, - 0x01, 0x28, 0x0b, 0x32, 0x2c, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, - 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x69, 0x65, 0x6c, 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, - 0x6e, 0x73, 0x2e, 0x46, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x53, 0x75, 0x70, 0x70, 0x6f, 0x72, - 0x74, 0x52, 0x0e, 0x66, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x53, 0x75, 0x70, 0x70, 0x6f, 0x72, - 0x74, 0x12, 0x58, 0x0a, 0x14, 0x75, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, - 0x65, 0x64, 0x5f, 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0xe7, 0x07, 0x20, 0x03, 0x28, 0x0b, - 0x32, 0x24, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, - 0x75, 0x66, 0x2e, 0x55, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, 0x64, - 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x13, 0x75, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, - 0x72, 0x65, 0x74, 0x65, 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x2a, 0x09, 0x08, 0xe8, 0x07, - 0x10, 0x80, 0x80, 0x80, 0x80, 0x02, 0x22, 0xd5, 0x01, 0x0a, 0x0e, 0x53, 0x65, 0x72, 0x76, 0x69, - 0x63, 0x65, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x12, 0x37, 0x0a, 0x08, 0x66, 0x65, 0x61, - 0x74, 0x75, 0x72, 0x65, 0x73, 0x18, 0x22, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1b, 0x2e, 0x67, 0x6f, - 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x65, - 0x61, 0x74, 0x75, 0x72, 0x65, 0x53, 0x65, 0x74, 0x52, 0x08, 0x66, 0x65, 0x61, 0x74, 0x75, 0x72, - 0x65, 0x73, 0x12, 0x25, 0x0a, 0x0a, 0x64, 0x65, 0x70, 0x72, 0x65, 0x63, 0x61, 0x74, 0x65, 0x64, - 0x18, 0x21, 0x20, 0x01, 0x28, 0x08, 0x3a, 0x05, 0x66, 0x61, 0x6c, 0x73, 0x65, 0x52, 0x0a, 0x64, - 0x65, 0x70, 0x72, 0x65, 0x63, 0x61, 0x74, 0x65, 0x64, 0x12, 0x58, 0x0a, 0x14, 0x75, 0x6e, 0x69, - 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, 0x64, 0x5f, 0x6f, 0x70, 0x74, 0x69, 0x6f, - 0x6e, 0x18, 0xe7, 0x07, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x24, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, - 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x55, 0x6e, 0x69, 0x6e, 0x74, - 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x13, - 0x75, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, 0x64, 0x4f, 0x70, 0x74, - 0x69, 0x6f, 0x6e, 0x2a, 0x09, 0x08, 0xe8, 0x07, 0x10, 0x80, 0x80, 0x80, 0x80, 0x02, 0x22, 0x99, - 0x03, 0x0a, 0x0d, 0x4d, 0x65, 0x74, 0x68, 0x6f, 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, - 0x12, 0x25, 0x0a, 0x0a, 0x64, 0x65, 0x70, 0x72, 0x65, 0x63, 0x61, 0x74, 0x65, 0x64, 0x18, 0x21, - 0x20, 0x01, 0x28, 0x08, 0x3a, 0x05, 0x66, 0x61, 0x6c, 0x73, 0x65, 0x52, 0x0a, 0x64, 0x65, 0x70, - 0x72, 0x65, 0x63, 0x61, 0x74, 0x65, 0x64, 0x12, 0x71, 0x0a, 0x11, 0x69, 0x64, 0x65, 0x6d, 0x70, - 0x6f, 0x74, 0x65, 0x6e, 0x63, 0x79, 0x5f, 0x6c, 0x65, 0x76, 0x65, 0x6c, 0x18, 0x22, 0x20, 0x01, - 0x28, 0x0e, 0x32, 0x2f, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, - 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x4d, 0x65, 0x74, 0x68, 0x6f, 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, - 0x6e, 0x73, 0x2e, 0x49, 0x64, 0x65, 0x6d, 0x70, 0x6f, 0x74, 0x65, 0x6e, 0x63, 0x79, 0x4c, 0x65, - 0x76, 0x65, 0x6c, 0x3a, 0x13, 0x49, 0x44, 0x45, 0x4d, 0x50, 0x4f, 0x54, 0x45, 0x4e, 0x43, 0x59, - 0x5f, 0x55, 0x4e, 0x4b, 0x4e, 0x4f, 0x57, 0x4e, 0x52, 0x10, 0x69, 0x64, 0x65, 0x6d, 0x70, 0x6f, - 0x74, 0x65, 0x6e, 0x63, 0x79, 0x4c, 0x65, 0x76, 0x65, 0x6c, 0x12, 0x37, 0x0a, 0x08, 0x66, 0x65, - 0x61, 0x74, 0x75, 0x72, 0x65, 0x73, 0x18, 0x23, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1b, 0x2e, 0x67, - 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, - 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x53, 0x65, 0x74, 0x52, 0x08, 0x66, 0x65, 0x61, 0x74, 0x75, - 0x72, 0x65, 0x73, 0x12, 0x58, 0x0a, 0x14, 0x75, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, - 0x65, 0x74, 0x65, 0x64, 0x5f, 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0xe7, 0x07, 0x20, 0x03, - 0x28, 0x0b, 0x32, 0x24, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, - 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x55, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, - 0x65, 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x13, 0x75, 0x6e, 0x69, 0x6e, 0x74, 0x65, - 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, 0x64, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x22, 0x50, 0x0a, - 0x10, 0x49, 0x64, 0x65, 0x6d, 0x70, 0x6f, 0x74, 0x65, 0x6e, 0x63, 0x79, 0x4c, 0x65, 0x76, 0x65, - 0x6c, 0x12, 0x17, 0x0a, 0x13, 0x49, 0x44, 0x45, 0x4d, 0x50, 0x4f, 0x54, 0x45, 0x4e, 0x43, 0x59, - 0x5f, 0x55, 0x4e, 0x4b, 0x4e, 0x4f, 0x57, 0x4e, 0x10, 0x00, 0x12, 0x13, 0x0a, 0x0f, 0x4e, 0x4f, - 0x5f, 0x53, 0x49, 0x44, 0x45, 0x5f, 0x45, 0x46, 0x46, 0x45, 0x43, 0x54, 0x53, 0x10, 0x01, 0x12, - 0x0e, 0x0a, 0x0a, 0x49, 0x44, 0x45, 0x4d, 0x50, 0x4f, 0x54, 0x45, 0x4e, 0x54, 0x10, 0x02, 0x2a, - 0x09, 0x08, 0xe8, 0x07, 0x10, 0x80, 0x80, 0x80, 0x80, 0x02, 0x22, 0x9a, 0x03, 0x0a, 0x13, 0x55, - 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, 0x64, 0x4f, 0x70, 0x74, 0x69, - 0x6f, 0x6e, 0x12, 0x41, 0x0a, 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x18, 0x02, 0x20, 0x03, 0x28, 0x0b, - 0x32, 0x2d, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, - 0x75, 0x66, 0x2e, 0x55, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, 0x64, - 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x4e, 0x61, 0x6d, 0x65, 0x50, 0x61, 0x72, 0x74, 0x52, - 0x04, 0x6e, 0x61, 0x6d, 0x65, 0x12, 0x29, 0x0a, 0x10, 0x69, 0x64, 0x65, 0x6e, 0x74, 0x69, 0x66, - 0x69, 0x65, 0x72, 0x5f, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, 0x52, - 0x0f, 0x69, 0x64, 0x65, 0x6e, 0x74, 0x69, 0x66, 0x69, 0x65, 0x72, 0x56, 0x61, 0x6c, 0x75, 0x65, - 0x12, 0x2c, 0x0a, 0x12, 0x70, 0x6f, 0x73, 0x69, 0x74, 0x69, 0x76, 0x65, 0x5f, 0x69, 0x6e, 0x74, - 0x5f, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x04, 0x20, 0x01, 0x28, 0x04, 0x52, 0x10, 0x70, 0x6f, - 0x73, 0x69, 0x74, 0x69, 0x76, 0x65, 0x49, 0x6e, 0x74, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x12, 0x2c, - 0x0a, 0x12, 0x6e, 0x65, 0x67, 0x61, 0x74, 0x69, 0x76, 0x65, 0x5f, 0x69, 0x6e, 0x74, 0x5f, 0x76, - 0x61, 0x6c, 0x75, 0x65, 0x18, 0x05, 0x20, 0x01, 0x28, 0x03, 0x52, 0x10, 0x6e, 0x65, 0x67, 0x61, - 0x74, 0x69, 0x76, 0x65, 0x49, 0x6e, 0x74, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x12, 0x21, 0x0a, 0x0c, - 0x64, 0x6f, 0x75, 0x62, 0x6c, 0x65, 0x5f, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x06, 0x20, 0x01, - 0x28, 0x01, 0x52, 0x0b, 0x64, 0x6f, 0x75, 0x62, 0x6c, 0x65, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x12, - 0x21, 0x0a, 0x0c, 0x73, 0x74, 0x72, 0x69, 0x6e, 0x67, 0x5f, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, - 0x07, 0x20, 0x01, 0x28, 0x0c, 0x52, 0x0b, 0x73, 0x74, 0x72, 0x69, 0x6e, 0x67, 0x56, 0x61, 0x6c, - 0x75, 0x65, 0x12, 0x27, 0x0a, 0x0f, 0x61, 0x67, 0x67, 0x72, 0x65, 0x67, 0x61, 0x74, 0x65, 0x5f, - 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x08, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0e, 0x61, 0x67, 0x67, - 0x72, 0x65, 0x67, 0x61, 0x74, 0x65, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x1a, 0x4a, 0x0a, 0x08, 0x4e, - 0x61, 0x6d, 0x65, 0x50, 0x61, 0x72, 0x74, 0x12, 0x1b, 0x0a, 0x09, 0x6e, 0x61, 0x6d, 0x65, 0x5f, - 0x70, 0x61, 0x72, 0x74, 0x18, 0x01, 0x20, 0x02, 0x28, 0x09, 0x52, 0x08, 0x6e, 0x61, 0x6d, 0x65, - 0x50, 0x61, 0x72, 0x74, 0x12, 0x21, 0x0a, 0x0c, 0x69, 0x73, 0x5f, 0x65, 0x78, 0x74, 0x65, 0x6e, - 0x73, 0x69, 0x6f, 0x6e, 0x18, 0x02, 0x20, 0x02, 0x28, 0x08, 0x52, 0x0b, 0x69, 0x73, 0x45, 0x78, - 0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x22, 0xa7, 0x0a, 0x0a, 0x0a, 0x46, 0x65, 0x61, 0x74, - 0x75, 0x72, 0x65, 0x53, 0x65, 0x74, 0x12, 0x91, 0x01, 0x0a, 0x0e, 0x66, 0x69, 0x65, 0x6c, 0x64, - 0x5f, 0x70, 0x72, 0x65, 0x73, 0x65, 0x6e, 0x63, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0e, 0x32, - 0x29, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, - 0x66, 0x2e, 0x46, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x53, 0x65, 0x74, 0x2e, 0x46, 0x69, 0x65, - 0x6c, 0x64, 0x50, 0x72, 0x65, 0x73, 0x65, 0x6e, 0x63, 0x65, 0x42, 0x3f, 0x88, 0x01, 0x01, 0x98, - 0x01, 0x04, 0x98, 0x01, 0x01, 0xa2, 0x01, 0x0d, 0x12, 0x08, 0x45, 0x58, 0x50, 0x4c, 0x49, 0x43, - 0x49, 0x54, 0x18, 0x84, 0x07, 0xa2, 0x01, 0x0d, 0x12, 0x08, 0x49, 0x4d, 0x50, 0x4c, 0x49, 0x43, - 0x49, 0x54, 0x18, 0xe7, 0x07, 0xa2, 0x01, 0x0d, 0x12, 0x08, 0x45, 0x58, 0x50, 0x4c, 0x49, 0x43, - 0x49, 0x54, 0x18, 0xe8, 0x07, 0xb2, 0x01, 0x03, 0x08, 0xe8, 0x07, 0x52, 0x0d, 0x66, 0x69, 0x65, - 0x6c, 0x64, 0x50, 0x72, 0x65, 0x73, 0x65, 0x6e, 0x63, 0x65, 0x12, 0x6c, 0x0a, 0x09, 0x65, 0x6e, - 0x75, 0x6d, 0x5f, 0x74, 0x79, 0x70, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x24, 0x2e, - 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, - 0x46, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x53, 0x65, 0x74, 0x2e, 0x45, 0x6e, 0x75, 0x6d, 0x54, - 0x79, 0x70, 0x65, 0x42, 0x29, 0x88, 0x01, 0x01, 0x98, 0x01, 0x06, 0x98, 0x01, 0x01, 0xa2, 0x01, - 0x0b, 0x12, 0x06, 0x43, 0x4c, 0x4f, 0x53, 0x45, 0x44, 0x18, 0x84, 0x07, 0xa2, 0x01, 0x09, 0x12, - 0x04, 0x4f, 0x50, 0x45, 0x4e, 0x18, 0xe7, 0x07, 0xb2, 0x01, 0x03, 0x08, 0xe8, 0x07, 0x52, 0x08, - 0x65, 0x6e, 0x75, 0x6d, 0x54, 0x79, 0x70, 0x65, 0x12, 0x98, 0x01, 0x0a, 0x17, 0x72, 0x65, 0x70, - 0x65, 0x61, 0x74, 0x65, 0x64, 0x5f, 0x66, 0x69, 0x65, 0x6c, 0x64, 0x5f, 0x65, 0x6e, 0x63, 0x6f, - 0x64, 0x69, 0x6e, 0x67, 0x18, 0x03, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x31, 0x2e, 0x67, 0x6f, 0x6f, - 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x65, 0x61, - 0x74, 0x75, 0x72, 0x65, 0x53, 0x65, 0x74, 0x2e, 0x52, 0x65, 0x70, 0x65, 0x61, 0x74, 0x65, 0x64, - 0x46, 0x69, 0x65, 0x6c, 0x64, 0x45, 0x6e, 0x63, 0x6f, 0x64, 0x69, 0x6e, 0x67, 0x42, 0x2d, 0x88, - 0x01, 0x01, 0x98, 0x01, 0x04, 0x98, 0x01, 0x01, 0xa2, 0x01, 0x0d, 0x12, 0x08, 0x45, 0x58, 0x50, - 0x41, 0x4e, 0x44, 0x45, 0x44, 0x18, 0x84, 0x07, 0xa2, 0x01, 0x0b, 0x12, 0x06, 0x50, 0x41, 0x43, - 0x4b, 0x45, 0x44, 0x18, 0xe7, 0x07, 0xb2, 0x01, 0x03, 0x08, 0xe8, 0x07, 0x52, 0x15, 0x72, 0x65, - 0x70, 0x65, 0x61, 0x74, 0x65, 0x64, 0x46, 0x69, 0x65, 0x6c, 0x64, 0x45, 0x6e, 0x63, 0x6f, 0x64, - 0x69, 0x6e, 0x67, 0x12, 0x7e, 0x0a, 0x0f, 0x75, 0x74, 0x66, 0x38, 0x5f, 0x76, 0x61, 0x6c, 0x69, - 0x64, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x04, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x2a, 0x2e, 0x67, - 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, - 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x53, 0x65, 0x74, 0x2e, 0x55, 0x74, 0x66, 0x38, 0x56, 0x61, - 0x6c, 0x69, 0x64, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x42, 0x29, 0x88, 0x01, 0x01, 0x98, 0x01, 0x04, - 0x98, 0x01, 0x01, 0xa2, 0x01, 0x09, 0x12, 0x04, 0x4e, 0x4f, 0x4e, 0x45, 0x18, 0x84, 0x07, 0xa2, - 0x01, 0x0b, 0x12, 0x06, 0x56, 0x45, 0x52, 0x49, 0x46, 0x59, 0x18, 0xe7, 0x07, 0xb2, 0x01, 0x03, - 0x08, 0xe8, 0x07, 0x52, 0x0e, 0x75, 0x74, 0x66, 0x38, 0x56, 0x61, 0x6c, 0x69, 0x64, 0x61, 0x74, - 0x69, 0x6f, 0x6e, 0x12, 0x7e, 0x0a, 0x10, 0x6d, 0x65, 0x73, 0x73, 0x61, 0x67, 0x65, 0x5f, 0x65, - 0x6e, 0x63, 0x6f, 0x64, 0x69, 0x6e, 0x67, 0x18, 0x05, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x2b, 0x2e, - 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, - 0x46, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x53, 0x65, 0x74, 0x2e, 0x4d, 0x65, 0x73, 0x73, 0x61, - 0x67, 0x65, 0x45, 0x6e, 0x63, 0x6f, 0x64, 0x69, 0x6e, 0x67, 0x42, 0x26, 0x88, 0x01, 0x01, 0x98, - 0x01, 0x04, 0x98, 0x01, 0x01, 0xa2, 0x01, 0x14, 0x12, 0x0f, 0x4c, 0x45, 0x4e, 0x47, 0x54, 0x48, - 0x5f, 0x50, 0x52, 0x45, 0x46, 0x49, 0x58, 0x45, 0x44, 0x18, 0x84, 0x07, 0xb2, 0x01, 0x03, 0x08, - 0xe8, 0x07, 0x52, 0x0f, 0x6d, 0x65, 0x73, 0x73, 0x61, 0x67, 0x65, 0x45, 0x6e, 0x63, 0x6f, 0x64, - 0x69, 0x6e, 0x67, 0x12, 0x82, 0x01, 0x0a, 0x0b, 0x6a, 0x73, 0x6f, 0x6e, 0x5f, 0x66, 0x6f, 0x72, - 0x6d, 0x61, 0x74, 0x18, 0x06, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x26, 0x2e, 0x67, 0x6f, 0x6f, 0x67, - 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x65, 0x61, 0x74, - 0x75, 0x72, 0x65, 0x53, 0x65, 0x74, 0x2e, 0x4a, 0x73, 0x6f, 0x6e, 0x46, 0x6f, 0x72, 0x6d, 0x61, - 0x74, 0x42, 0x39, 0x88, 0x01, 0x01, 0x98, 0x01, 0x03, 0x98, 0x01, 0x06, 0x98, 0x01, 0x01, 0xa2, - 0x01, 0x17, 0x12, 0x12, 0x4c, 0x45, 0x47, 0x41, 0x43, 0x59, 0x5f, 0x42, 0x45, 0x53, 0x54, 0x5f, - 0x45, 0x46, 0x46, 0x4f, 0x52, 0x54, 0x18, 0x84, 0x07, 0xa2, 0x01, 0x0a, 0x12, 0x05, 0x41, 0x4c, - 0x4c, 0x4f, 0x57, 0x18, 0xe7, 0x07, 0xb2, 0x01, 0x03, 0x08, 0xe8, 0x07, 0x52, 0x0a, 0x6a, 0x73, - 0x6f, 0x6e, 0x46, 0x6f, 0x72, 0x6d, 0x61, 0x74, 0x22, 0x5c, 0x0a, 0x0d, 0x46, 0x69, 0x65, 0x6c, - 0x64, 0x50, 0x72, 0x65, 0x73, 0x65, 0x6e, 0x63, 0x65, 0x12, 0x1a, 0x0a, 0x16, 0x46, 0x49, 0x45, - 0x4c, 0x44, 0x5f, 0x50, 0x52, 0x45, 0x53, 0x45, 0x4e, 0x43, 0x45, 0x5f, 0x55, 0x4e, 0x4b, 0x4e, - 0x4f, 0x57, 0x4e, 0x10, 0x00, 0x12, 0x0c, 0x0a, 0x08, 0x45, 0x58, 0x50, 0x4c, 0x49, 0x43, 0x49, - 0x54, 0x10, 0x01, 0x12, 0x0c, 0x0a, 0x08, 0x49, 0x4d, 0x50, 0x4c, 0x49, 0x43, 0x49, 0x54, 0x10, - 0x02, 0x12, 0x13, 0x0a, 0x0f, 0x4c, 0x45, 0x47, 0x41, 0x43, 0x59, 0x5f, 0x52, 0x45, 0x51, 0x55, - 0x49, 0x52, 0x45, 0x44, 0x10, 0x03, 0x22, 0x37, 0x0a, 0x08, 0x45, 0x6e, 0x75, 0x6d, 0x54, 0x79, - 0x70, 0x65, 0x12, 0x15, 0x0a, 0x11, 0x45, 0x4e, 0x55, 0x4d, 0x5f, 0x54, 0x59, 0x50, 0x45, 0x5f, - 0x55, 0x4e, 0x4b, 0x4e, 0x4f, 0x57, 0x4e, 0x10, 0x00, 0x12, 0x08, 0x0a, 0x04, 0x4f, 0x50, 0x45, - 0x4e, 0x10, 0x01, 0x12, 0x0a, 0x0a, 0x06, 0x43, 0x4c, 0x4f, 0x53, 0x45, 0x44, 0x10, 0x02, 0x22, - 0x56, 0x0a, 0x15, 0x52, 0x65, 0x70, 0x65, 0x61, 0x74, 0x65, 0x64, 0x46, 0x69, 0x65, 0x6c, 0x64, - 0x45, 0x6e, 0x63, 0x6f, 0x64, 0x69, 0x6e, 0x67, 0x12, 0x23, 0x0a, 0x1f, 0x52, 0x45, 0x50, 0x45, - 0x41, 0x54, 0x45, 0x44, 0x5f, 0x46, 0x49, 0x45, 0x4c, 0x44, 0x5f, 0x45, 0x4e, 0x43, 0x4f, 0x44, - 0x49, 0x4e, 0x47, 0x5f, 0x55, 0x4e, 0x4b, 0x4e, 0x4f, 0x57, 0x4e, 0x10, 0x00, 0x12, 0x0a, 0x0a, - 0x06, 0x50, 0x41, 0x43, 0x4b, 0x45, 0x44, 0x10, 0x01, 0x12, 0x0c, 0x0a, 0x08, 0x45, 0x58, 0x50, - 0x41, 0x4e, 0x44, 0x45, 0x44, 0x10, 0x02, 0x22, 0x49, 0x0a, 0x0e, 0x55, 0x74, 0x66, 0x38, 0x56, - 0x61, 0x6c, 0x69, 0x64, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x1b, 0x0a, 0x17, 0x55, 0x54, 0x46, - 0x38, 0x5f, 0x56, 0x41, 0x4c, 0x49, 0x44, 0x41, 0x54, 0x49, 0x4f, 0x4e, 0x5f, 0x55, 0x4e, 0x4b, - 0x4e, 0x4f, 0x57, 0x4e, 0x10, 0x00, 0x12, 0x0a, 0x0a, 0x06, 0x56, 0x45, 0x52, 0x49, 0x46, 0x59, - 0x10, 0x02, 0x12, 0x08, 0x0a, 0x04, 0x4e, 0x4f, 0x4e, 0x45, 0x10, 0x03, 0x22, 0x04, 0x08, 0x01, - 0x10, 0x01, 0x22, 0x53, 0x0a, 0x0f, 0x4d, 0x65, 0x73, 0x73, 0x61, 0x67, 0x65, 0x45, 0x6e, 0x63, - 0x6f, 0x64, 0x69, 0x6e, 0x67, 0x12, 0x1c, 0x0a, 0x18, 0x4d, 0x45, 0x53, 0x53, 0x41, 0x47, 0x45, - 0x5f, 0x45, 0x4e, 0x43, 0x4f, 0x44, 0x49, 0x4e, 0x47, 0x5f, 0x55, 0x4e, 0x4b, 0x4e, 0x4f, 0x57, - 0x4e, 0x10, 0x00, 0x12, 0x13, 0x0a, 0x0f, 0x4c, 0x45, 0x4e, 0x47, 0x54, 0x48, 0x5f, 0x50, 0x52, - 0x45, 0x46, 0x49, 0x58, 0x45, 0x44, 0x10, 0x01, 0x12, 0x0d, 0x0a, 0x09, 0x44, 0x45, 0x4c, 0x49, - 0x4d, 0x49, 0x54, 0x45, 0x44, 0x10, 0x02, 0x22, 0x48, 0x0a, 0x0a, 0x4a, 0x73, 0x6f, 0x6e, 0x46, - 0x6f, 0x72, 0x6d, 0x61, 0x74, 0x12, 0x17, 0x0a, 0x13, 0x4a, 0x53, 0x4f, 0x4e, 0x5f, 0x46, 0x4f, - 0x52, 0x4d, 0x41, 0x54, 0x5f, 0x55, 0x4e, 0x4b, 0x4e, 0x4f, 0x57, 0x4e, 0x10, 0x00, 0x12, 0x09, - 0x0a, 0x05, 0x41, 0x4c, 0x4c, 0x4f, 0x57, 0x10, 0x01, 0x12, 0x16, 0x0a, 0x12, 0x4c, 0x45, 0x47, - 0x41, 0x43, 0x59, 0x5f, 0x42, 0x45, 0x53, 0x54, 0x5f, 0x45, 0x46, 0x46, 0x4f, 0x52, 0x54, 0x10, - 0x02, 0x2a, 0x06, 0x08, 0xe8, 0x07, 0x10, 0x8b, 0x4e, 0x2a, 0x06, 0x08, 0x8b, 0x4e, 0x10, 0x90, - 0x4e, 0x2a, 0x06, 0x08, 0x90, 0x4e, 0x10, 0x91, 0x4e, 0x4a, 0x06, 0x08, 0xe7, 0x07, 0x10, 0xe8, - 0x07, 0x22, 0xef, 0x03, 0x0a, 0x12, 0x46, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x53, 0x65, 0x74, - 0x44, 0x65, 0x66, 0x61, 0x75, 0x6c, 0x74, 0x73, 0x12, 0x58, 0x0a, 0x08, 0x64, 0x65, 0x66, 0x61, - 0x75, 0x6c, 0x74, 0x73, 0x18, 0x01, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x3c, 0x2e, 0x67, 0x6f, 0x6f, - 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x65, 0x61, - 0x74, 0x75, 0x72, 0x65, 0x53, 0x65, 0x74, 0x44, 0x65, 0x66, 0x61, 0x75, 0x6c, 0x74, 0x73, 0x2e, - 0x46, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x53, 0x65, 0x74, 0x45, 0x64, 0x69, 0x74, 0x69, 0x6f, - 0x6e, 0x44, 0x65, 0x66, 0x61, 0x75, 0x6c, 0x74, 0x52, 0x08, 0x64, 0x65, 0x66, 0x61, 0x75, 0x6c, - 0x74, 0x73, 0x12, 0x41, 0x0a, 0x0f, 0x6d, 0x69, 0x6e, 0x69, 0x6d, 0x75, 0x6d, 0x5f, 0x65, 0x64, - 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x04, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x18, 0x2e, 0x67, 0x6f, - 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x45, 0x64, - 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x0e, 0x6d, 0x69, 0x6e, 0x69, 0x6d, 0x75, 0x6d, 0x45, 0x64, - 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x41, 0x0a, 0x0f, 0x6d, 0x61, 0x78, 0x69, 0x6d, 0x75, 0x6d, - 0x5f, 0x65, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x18, 0x05, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x18, - 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, - 0x2e, 0x45, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x0e, 0x6d, 0x61, 0x78, 0x69, 0x6d, 0x75, - 0x6d, 0x45, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x1a, 0xf8, 0x01, 0x0a, 0x18, 0x46, 0x65, 0x61, - 0x74, 0x75, 0x72, 0x65, 0x53, 0x65, 0x74, 0x45, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x44, 0x65, - 0x66, 0x61, 0x75, 0x6c, 0x74, 0x12, 0x32, 0x0a, 0x07, 0x65, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, - 0x18, 0x03, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x18, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, - 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x45, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, - 0x52, 0x07, 0x65, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x4e, 0x0a, 0x14, 0x6f, 0x76, 0x65, - 0x72, 0x72, 0x69, 0x64, 0x61, 0x62, 0x6c, 0x65, 0x5f, 0x66, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, - 0x73, 0x18, 0x04, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1b, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, - 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x46, 0x65, 0x61, 0x74, 0x75, 0x72, - 0x65, 0x53, 0x65, 0x74, 0x52, 0x13, 0x6f, 0x76, 0x65, 0x72, 0x72, 0x69, 0x64, 0x61, 0x62, 0x6c, - 0x65, 0x46, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x73, 0x12, 0x42, 0x0a, 0x0e, 0x66, 0x69, 0x78, - 0x65, 0x64, 0x5f, 0x66, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x73, 0x18, 0x05, 0x20, 0x01, 0x28, - 0x0b, 0x32, 0x1b, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, - 0x62, 0x75, 0x66, 0x2e, 0x46, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x53, 0x65, 0x74, 0x52, 0x0d, - 0x66, 0x69, 0x78, 0x65, 0x64, 0x46, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x73, 0x4a, 0x04, 0x08, - 0x01, 0x10, 0x02, 0x4a, 0x04, 0x08, 0x02, 0x10, 0x03, 0x52, 0x08, 0x66, 0x65, 0x61, 0x74, 0x75, - 0x72, 0x65, 0x73, 0x22, 0xb5, 0x02, 0x0a, 0x0e, 0x53, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x43, 0x6f, - 0x64, 0x65, 0x49, 0x6e, 0x66, 0x6f, 0x12, 0x44, 0x0a, 0x08, 0x6c, 0x6f, 0x63, 0x61, 0x74, 0x69, - 0x6f, 0x6e, 0x18, 0x01, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x28, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, - 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x53, 0x6f, 0x75, 0x72, 0x63, - 0x65, 0x43, 0x6f, 0x64, 0x65, 0x49, 0x6e, 0x66, 0x6f, 0x2e, 0x4c, 0x6f, 0x63, 0x61, 0x74, 0x69, - 0x6f, 0x6e, 0x52, 0x08, 0x6c, 0x6f, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x1a, 0xce, 0x01, 0x0a, - 0x08, 0x4c, 0x6f, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x16, 0x0a, 0x04, 0x70, 0x61, 0x74, - 0x68, 0x18, 0x01, 0x20, 0x03, 0x28, 0x05, 0x42, 0x02, 0x10, 0x01, 0x52, 0x04, 0x70, 0x61, 0x74, - 0x68, 0x12, 0x16, 0x0a, 0x04, 0x73, 0x70, 0x61, 0x6e, 0x18, 0x02, 0x20, 0x03, 0x28, 0x05, 0x42, - 0x02, 0x10, 0x01, 0x52, 0x04, 0x73, 0x70, 0x61, 0x6e, 0x12, 0x29, 0x0a, 0x10, 0x6c, 0x65, 0x61, - 0x64, 0x69, 0x6e, 0x67, 0x5f, 0x63, 0x6f, 0x6d, 0x6d, 0x65, 0x6e, 0x74, 0x73, 0x18, 0x03, 0x20, - 0x01, 0x28, 0x09, 0x52, 0x0f, 0x6c, 0x65, 0x61, 0x64, 0x69, 0x6e, 0x67, 0x43, 0x6f, 0x6d, 0x6d, - 0x65, 0x6e, 0x74, 0x73, 0x12, 0x2b, 0x0a, 0x11, 0x74, 0x72, 0x61, 0x69, 0x6c, 0x69, 0x6e, 0x67, - 0x5f, 0x63, 0x6f, 0x6d, 0x6d, 0x65, 0x6e, 0x74, 0x73, 0x18, 0x04, 0x20, 0x01, 0x28, 0x09, 0x52, - 0x10, 0x74, 0x72, 0x61, 0x69, 0x6c, 0x69, 0x6e, 0x67, 0x43, 0x6f, 0x6d, 0x6d, 0x65, 0x6e, 0x74, - 0x73, 0x12, 0x3a, 0x0a, 0x19, 0x6c, 0x65, 0x61, 0x64, 0x69, 0x6e, 0x67, 0x5f, 0x64, 0x65, 0x74, - 0x61, 0x63, 0x68, 0x65, 0x64, 0x5f, 0x63, 0x6f, 0x6d, 0x6d, 0x65, 0x6e, 0x74, 0x73, 0x18, 0x06, - 0x20, 0x03, 0x28, 0x09, 0x52, 0x17, 0x6c, 0x65, 0x61, 0x64, 0x69, 0x6e, 0x67, 0x44, 0x65, 0x74, - 0x61, 0x63, 0x68, 0x65, 0x64, 0x43, 0x6f, 0x6d, 0x6d, 0x65, 0x6e, 0x74, 0x73, 0x2a, 0x0c, 0x08, - 0x80, 0xec, 0xca, 0xff, 0x01, 0x10, 0x81, 0xec, 0xca, 0xff, 0x01, 0x22, 0xd0, 0x02, 0x0a, 0x11, - 0x47, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x65, 0x64, 0x43, 0x6f, 0x64, 0x65, 0x49, 0x6e, 0x66, - 0x6f, 0x12, 0x4d, 0x0a, 0x0a, 0x61, 0x6e, 0x6e, 0x6f, 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x18, - 0x01, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x2d, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, - 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x47, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x65, - 0x64, 0x43, 0x6f, 0x64, 0x65, 0x49, 0x6e, 0x66, 0x6f, 0x2e, 0x41, 0x6e, 0x6e, 0x6f, 0x74, 0x61, - 0x74, 0x69, 0x6f, 0x6e, 0x52, 0x0a, 0x61, 0x6e, 0x6e, 0x6f, 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, - 0x1a, 0xeb, 0x01, 0x0a, 0x0a, 0x41, 0x6e, 0x6e, 0x6f, 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, - 0x16, 0x0a, 0x04, 0x70, 0x61, 0x74, 0x68, 0x18, 0x01, 0x20, 0x03, 0x28, 0x05, 0x42, 0x02, 0x10, - 0x01, 0x52, 0x04, 0x70, 0x61, 0x74, 0x68, 0x12, 0x1f, 0x0a, 0x0b, 0x73, 0x6f, 0x75, 0x72, 0x63, - 0x65, 0x5f, 0x66, 0x69, 0x6c, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x09, 0x52, 0x0a, 0x73, 0x6f, - 0x75, 0x72, 0x63, 0x65, 0x46, 0x69, 0x6c, 0x65, 0x12, 0x14, 0x0a, 0x05, 0x62, 0x65, 0x67, 0x69, - 0x6e, 0x18, 0x03, 0x20, 0x01, 0x28, 0x05, 0x52, 0x05, 0x62, 0x65, 0x67, 0x69, 0x6e, 0x12, 0x10, - 0x0a, 0x03, 0x65, 0x6e, 0x64, 0x18, 0x04, 0x20, 0x01, 0x28, 0x05, 0x52, 0x03, 0x65, 0x6e, 0x64, - 0x12, 0x52, 0x0a, 0x08, 0x73, 0x65, 0x6d, 0x61, 0x6e, 0x74, 0x69, 0x63, 0x18, 0x05, 0x20, 0x01, - 0x28, 0x0e, 0x32, 0x36, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, - 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x47, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x65, 0x64, 0x43, 0x6f, - 0x64, 0x65, 0x49, 0x6e, 0x66, 0x6f, 0x2e, 0x41, 0x6e, 0x6e, 0x6f, 0x74, 0x61, 0x74, 0x69, 0x6f, - 0x6e, 0x2e, 0x53, 0x65, 0x6d, 0x61, 0x6e, 0x74, 0x69, 0x63, 0x52, 0x08, 0x73, 0x65, 0x6d, 0x61, - 0x6e, 0x74, 0x69, 0x63, 0x22, 0x28, 0x0a, 0x08, 0x53, 0x65, 0x6d, 0x61, 0x6e, 0x74, 0x69, 0x63, - 0x12, 0x08, 0x0a, 0x04, 0x4e, 0x4f, 0x4e, 0x45, 0x10, 0x00, 0x12, 0x07, 0x0a, 0x03, 0x53, 0x45, - 0x54, 0x10, 0x01, 0x12, 0x09, 0x0a, 0x05, 0x41, 0x4c, 0x49, 0x41, 0x53, 0x10, 0x02, 0x2a, 0xa7, - 0x02, 0x0a, 0x07, 0x45, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x13, 0x0a, 0x0f, 0x45, 0x44, - 0x49, 0x54, 0x49, 0x4f, 0x4e, 0x5f, 0x55, 0x4e, 0x4b, 0x4e, 0x4f, 0x57, 0x4e, 0x10, 0x00, 0x12, - 0x13, 0x0a, 0x0e, 0x45, 0x44, 0x49, 0x54, 0x49, 0x4f, 0x4e, 0x5f, 0x4c, 0x45, 0x47, 0x41, 0x43, - 0x59, 0x10, 0x84, 0x07, 0x12, 0x13, 0x0a, 0x0e, 0x45, 0x44, 0x49, 0x54, 0x49, 0x4f, 0x4e, 0x5f, - 0x50, 0x52, 0x4f, 0x54, 0x4f, 0x32, 0x10, 0xe6, 0x07, 0x12, 0x13, 0x0a, 0x0e, 0x45, 0x44, 0x49, - 0x54, 0x49, 0x4f, 0x4e, 0x5f, 0x50, 0x52, 0x4f, 0x54, 0x4f, 0x33, 0x10, 0xe7, 0x07, 0x12, 0x11, - 0x0a, 0x0c, 0x45, 0x44, 0x49, 0x54, 0x49, 0x4f, 0x4e, 0x5f, 0x32, 0x30, 0x32, 0x33, 0x10, 0xe8, - 0x07, 0x12, 0x11, 0x0a, 0x0c, 0x45, 0x44, 0x49, 0x54, 0x49, 0x4f, 0x4e, 0x5f, 0x32, 0x30, 0x32, - 0x34, 0x10, 0xe9, 0x07, 0x12, 0x17, 0x0a, 0x13, 0x45, 0x44, 0x49, 0x54, 0x49, 0x4f, 0x4e, 0x5f, - 0x31, 0x5f, 0x54, 0x45, 0x53, 0x54, 0x5f, 0x4f, 0x4e, 0x4c, 0x59, 0x10, 0x01, 0x12, 0x17, 0x0a, - 0x13, 0x45, 0x44, 0x49, 0x54, 0x49, 0x4f, 0x4e, 0x5f, 0x32, 0x5f, 0x54, 0x45, 0x53, 0x54, 0x5f, - 0x4f, 0x4e, 0x4c, 0x59, 0x10, 0x02, 0x12, 0x1d, 0x0a, 0x17, 0x45, 0x44, 0x49, 0x54, 0x49, 0x4f, - 0x4e, 0x5f, 0x39, 0x39, 0x39, 0x39, 0x37, 0x5f, 0x54, 0x45, 0x53, 0x54, 0x5f, 0x4f, 0x4e, 0x4c, - 0x59, 0x10, 0x9d, 0x8d, 0x06, 0x12, 0x1d, 0x0a, 0x17, 0x45, 0x44, 0x49, 0x54, 0x49, 0x4f, 0x4e, - 0x5f, 0x39, 0x39, 0x39, 0x39, 0x38, 0x5f, 0x54, 0x45, 0x53, 0x54, 0x5f, 0x4f, 0x4e, 0x4c, 0x59, - 0x10, 0x9e, 0x8d, 0x06, 0x12, 0x1d, 0x0a, 0x17, 0x45, 0x44, 0x49, 0x54, 0x49, 0x4f, 0x4e, 0x5f, - 0x39, 0x39, 0x39, 0x39, 0x39, 0x5f, 0x54, 0x45, 0x53, 0x54, 0x5f, 0x4f, 0x4e, 0x4c, 0x59, 0x10, - 0x9f, 0x8d, 0x06, 0x12, 0x13, 0x0a, 0x0b, 0x45, 0x44, 0x49, 0x54, 0x49, 0x4f, 0x4e, 0x5f, 0x4d, - 0x41, 0x58, 0x10, 0xff, 0xff, 0xff, 0xff, 0x07, 0x42, 0x7e, 0x0a, 0x13, 0x63, 0x6f, 0x6d, 0x2e, - 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x42, - 0x10, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, 0x50, 0x72, 0x6f, 0x74, 0x6f, - 0x73, 0x48, 0x01, 0x5a, 0x2d, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x67, 0x6f, 0x6c, 0x61, - 0x6e, 0x67, 0x2e, 0x6f, 0x72, 0x67, 0x2f, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2f, - 0x74, 0x79, 0x70, 0x65, 0x73, 0x2f, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x6f, 0x72, - 0x70, 0x62, 0xf8, 0x01, 0x01, 0xa2, 0x02, 0x03, 0x47, 0x50, 0x42, 0xaa, 0x02, 0x1a, 0x47, 0x6f, - 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x52, 0x65, - 0x66, 0x6c, 0x65, 0x63, 0x74, 0x69, 0x6f, 0x6e, -}) +const file_google_protobuf_descriptor_proto_rawDesc = "" + + "\n" + + " google/protobuf/descriptor.proto\x12\x0fgoogle.protobuf\"[\n" + + "\x11FileDescriptorSet\x128\n" + + "\x04file\x18\x01 \x03(\v2$.google.protobuf.FileDescriptorProtoR\x04file*\f\b\x80\xec\xca\xff\x01\x10\x81\xec\xca\xff\x01\"\x98\x05\n" + + "\x13FileDescriptorProto\x12\x12\n" + + "\x04name\x18\x01 \x01(\tR\x04name\x12\x18\n" + + "\apackage\x18\x02 \x01(\tR\apackage\x12\x1e\n" + + "\n" + + "dependency\x18\x03 \x03(\tR\n" + + "dependency\x12+\n" + + "\x11public_dependency\x18\n" + + " \x03(\x05R\x10publicDependency\x12'\n" + + "\x0fweak_dependency\x18\v \x03(\x05R\x0eweakDependency\x12C\n" + + "\fmessage_type\x18\x04 \x03(\v2 .google.protobuf.DescriptorProtoR\vmessageType\x12A\n" + + "\tenum_type\x18\x05 \x03(\v2$.google.protobuf.EnumDescriptorProtoR\benumType\x12A\n" + + "\aservice\x18\x06 \x03(\v2'.google.protobuf.ServiceDescriptorProtoR\aservice\x12C\n" + + "\textension\x18\a \x03(\v2%.google.protobuf.FieldDescriptorProtoR\textension\x126\n" + + "\aoptions\x18\b \x01(\v2\x1c.google.protobuf.FileOptionsR\aoptions\x12I\n" + + "\x10source_code_info\x18\t \x01(\v2\x1f.google.protobuf.SourceCodeInfoR\x0esourceCodeInfo\x12\x16\n" + + "\x06syntax\x18\f \x01(\tR\x06syntax\x122\n" + + "\aedition\x18\x0e \x01(\x0e2\x18.google.protobuf.EditionR\aedition\"\xb9\x06\n" + + "\x0fDescriptorProto\x12\x12\n" + + "\x04name\x18\x01 \x01(\tR\x04name\x12;\n" + + "\x05field\x18\x02 \x03(\v2%.google.protobuf.FieldDescriptorProtoR\x05field\x12C\n" + + "\textension\x18\x06 \x03(\v2%.google.protobuf.FieldDescriptorProtoR\textension\x12A\n" + + "\vnested_type\x18\x03 \x03(\v2 .google.protobuf.DescriptorProtoR\n" + + "nestedType\x12A\n" + + "\tenum_type\x18\x04 \x03(\v2$.google.protobuf.EnumDescriptorProtoR\benumType\x12X\n" + + "\x0fextension_range\x18\x05 \x03(\v2/.google.protobuf.DescriptorProto.ExtensionRangeR\x0eextensionRange\x12D\n" + + "\n" + + "oneof_decl\x18\b \x03(\v2%.google.protobuf.OneofDescriptorProtoR\toneofDecl\x129\n" + + "\aoptions\x18\a \x01(\v2\x1f.google.protobuf.MessageOptionsR\aoptions\x12U\n" + + "\x0ereserved_range\x18\t \x03(\v2..google.protobuf.DescriptorProto.ReservedRangeR\rreservedRange\x12#\n" + + "\rreserved_name\x18\n" + + " \x03(\tR\freservedName\x1az\n" + + "\x0eExtensionRange\x12\x14\n" + + "\x05start\x18\x01 \x01(\x05R\x05start\x12\x10\n" + + "\x03end\x18\x02 \x01(\x05R\x03end\x12@\n" + + "\aoptions\x18\x03 \x01(\v2&.google.protobuf.ExtensionRangeOptionsR\aoptions\x1a7\n" + + "\rReservedRange\x12\x14\n" + + "\x05start\x18\x01 \x01(\x05R\x05start\x12\x10\n" + + "\x03end\x18\x02 \x01(\x05R\x03end\"\xcc\x04\n" + + "\x15ExtensionRangeOptions\x12X\n" + + "\x14uninterpreted_option\x18\xe7\a \x03(\v2$.google.protobuf.UninterpretedOptionR\x13uninterpretedOption\x12Y\n" + + "\vdeclaration\x18\x02 \x03(\v22.google.protobuf.ExtensionRangeOptions.DeclarationB\x03\x88\x01\x02R\vdeclaration\x127\n" + + "\bfeatures\x182 \x01(\v2\x1b.google.protobuf.FeatureSetR\bfeatures\x12m\n" + + "\fverification\x18\x03 \x01(\x0e28.google.protobuf.ExtensionRangeOptions.VerificationState:\n" + + "UNVERIFIEDB\x03\x88\x01\x02R\fverification\x1a\x94\x01\n" + + "\vDeclaration\x12\x16\n" + + "\x06number\x18\x01 \x01(\x05R\x06number\x12\x1b\n" + + "\tfull_name\x18\x02 \x01(\tR\bfullName\x12\x12\n" + + "\x04type\x18\x03 \x01(\tR\x04type\x12\x1a\n" + + "\breserved\x18\x05 \x01(\bR\breserved\x12\x1a\n" + + "\brepeated\x18\x06 \x01(\bR\brepeatedJ\x04\b\x04\x10\x05\"4\n" + + "\x11VerificationState\x12\x0f\n" + + "\vDECLARATION\x10\x00\x12\x0e\n" + + "\n" + + "UNVERIFIED\x10\x01*\t\b\xe8\a\x10\x80\x80\x80\x80\x02\"\xc1\x06\n" + + "\x14FieldDescriptorProto\x12\x12\n" + + "\x04name\x18\x01 \x01(\tR\x04name\x12\x16\n" + + "\x06number\x18\x03 \x01(\x05R\x06number\x12A\n" + + "\x05label\x18\x04 \x01(\x0e2+.google.protobuf.FieldDescriptorProto.LabelR\x05label\x12>\n" + + "\x04type\x18\x05 \x01(\x0e2*.google.protobuf.FieldDescriptorProto.TypeR\x04type\x12\x1b\n" + + "\ttype_name\x18\x06 \x01(\tR\btypeName\x12\x1a\n" + + "\bextendee\x18\x02 \x01(\tR\bextendee\x12#\n" + + "\rdefault_value\x18\a \x01(\tR\fdefaultValue\x12\x1f\n" + + "\voneof_index\x18\t \x01(\x05R\n" + + "oneofIndex\x12\x1b\n" + + "\tjson_name\x18\n" + + " \x01(\tR\bjsonName\x127\n" + + "\aoptions\x18\b \x01(\v2\x1d.google.protobuf.FieldOptionsR\aoptions\x12'\n" + + "\x0fproto3_optional\x18\x11 \x01(\bR\x0eproto3Optional\"\xb6\x02\n" + + "\x04Type\x12\x0f\n" + + "\vTYPE_DOUBLE\x10\x01\x12\x0e\n" + + "\n" + + "TYPE_FLOAT\x10\x02\x12\x0e\n" + + "\n" + + "TYPE_INT64\x10\x03\x12\x0f\n" + + "\vTYPE_UINT64\x10\x04\x12\x0e\n" + + "\n" + + "TYPE_INT32\x10\x05\x12\x10\n" + + "\fTYPE_FIXED64\x10\x06\x12\x10\n" + + "\fTYPE_FIXED32\x10\a\x12\r\n" + + "\tTYPE_BOOL\x10\b\x12\x0f\n" + + "\vTYPE_STRING\x10\t\x12\x0e\n" + + "\n" + + "TYPE_GROUP\x10\n" + + "\x12\x10\n" + + "\fTYPE_MESSAGE\x10\v\x12\x0e\n" + + "\n" + + "TYPE_BYTES\x10\f\x12\x0f\n" + + "\vTYPE_UINT32\x10\r\x12\r\n" + + "\tTYPE_ENUM\x10\x0e\x12\x11\n" + + "\rTYPE_SFIXED32\x10\x0f\x12\x11\n" + + "\rTYPE_SFIXED64\x10\x10\x12\x0f\n" + + "\vTYPE_SINT32\x10\x11\x12\x0f\n" + + "\vTYPE_SINT64\x10\x12\"C\n" + + "\x05Label\x12\x12\n" + + "\x0eLABEL_OPTIONAL\x10\x01\x12\x12\n" + + "\x0eLABEL_REPEATED\x10\x03\x12\x12\n" + + "\x0eLABEL_REQUIRED\x10\x02\"c\n" + + "\x14OneofDescriptorProto\x12\x12\n" + + "\x04name\x18\x01 \x01(\tR\x04name\x127\n" + + "\aoptions\x18\x02 \x01(\v2\x1d.google.protobuf.OneofOptionsR\aoptions\"\xe3\x02\n" + + "\x13EnumDescriptorProto\x12\x12\n" + + "\x04name\x18\x01 \x01(\tR\x04name\x12?\n" + + "\x05value\x18\x02 \x03(\v2).google.protobuf.EnumValueDescriptorProtoR\x05value\x126\n" + + "\aoptions\x18\x03 \x01(\v2\x1c.google.protobuf.EnumOptionsR\aoptions\x12]\n" + + "\x0ereserved_range\x18\x04 \x03(\v26.google.protobuf.EnumDescriptorProto.EnumReservedRangeR\rreservedRange\x12#\n" + + "\rreserved_name\x18\x05 \x03(\tR\freservedName\x1a;\n" + + "\x11EnumReservedRange\x12\x14\n" + + "\x05start\x18\x01 \x01(\x05R\x05start\x12\x10\n" + + "\x03end\x18\x02 \x01(\x05R\x03end\"\x83\x01\n" + + "\x18EnumValueDescriptorProto\x12\x12\n" + + "\x04name\x18\x01 \x01(\tR\x04name\x12\x16\n" + + "\x06number\x18\x02 \x01(\x05R\x06number\x12;\n" + + "\aoptions\x18\x03 \x01(\v2!.google.protobuf.EnumValueOptionsR\aoptions\"\xa7\x01\n" + + "\x16ServiceDescriptorProto\x12\x12\n" + + "\x04name\x18\x01 \x01(\tR\x04name\x12>\n" + + "\x06method\x18\x02 \x03(\v2&.google.protobuf.MethodDescriptorProtoR\x06method\x129\n" + + "\aoptions\x18\x03 \x01(\v2\x1f.google.protobuf.ServiceOptionsR\aoptions\"\x89\x02\n" + + "\x15MethodDescriptorProto\x12\x12\n" + + "\x04name\x18\x01 \x01(\tR\x04name\x12\x1d\n" + + "\n" + + "input_type\x18\x02 \x01(\tR\tinputType\x12\x1f\n" + + "\voutput_type\x18\x03 \x01(\tR\n" + + "outputType\x128\n" + + "\aoptions\x18\x04 \x01(\v2\x1e.google.protobuf.MethodOptionsR\aoptions\x120\n" + + "\x10client_streaming\x18\x05 \x01(\b:\x05falseR\x0fclientStreaming\x120\n" + + "\x10server_streaming\x18\x06 \x01(\b:\x05falseR\x0fserverStreaming\"\xad\t\n" + + "\vFileOptions\x12!\n" + + "\fjava_package\x18\x01 \x01(\tR\vjavaPackage\x120\n" + + "\x14java_outer_classname\x18\b \x01(\tR\x12javaOuterClassname\x125\n" + + "\x13java_multiple_files\x18\n" + + " \x01(\b:\x05falseR\x11javaMultipleFiles\x12D\n" + + "\x1djava_generate_equals_and_hash\x18\x14 \x01(\bB\x02\x18\x01R\x19javaGenerateEqualsAndHash\x12:\n" + + "\x16java_string_check_utf8\x18\x1b \x01(\b:\x05falseR\x13javaStringCheckUtf8\x12S\n" + + "\foptimize_for\x18\t \x01(\x0e2).google.protobuf.FileOptions.OptimizeMode:\x05SPEEDR\voptimizeFor\x12\x1d\n" + + "\n" + + "go_package\x18\v \x01(\tR\tgoPackage\x125\n" + + "\x13cc_generic_services\x18\x10 \x01(\b:\x05falseR\x11ccGenericServices\x129\n" + + "\x15java_generic_services\x18\x11 \x01(\b:\x05falseR\x13javaGenericServices\x125\n" + + "\x13py_generic_services\x18\x12 \x01(\b:\x05falseR\x11pyGenericServices\x12%\n" + + "\n" + + "deprecated\x18\x17 \x01(\b:\x05falseR\n" + + "deprecated\x12.\n" + + "\x10cc_enable_arenas\x18\x1f \x01(\b:\x04trueR\x0eccEnableArenas\x12*\n" + + "\x11objc_class_prefix\x18$ \x01(\tR\x0fobjcClassPrefix\x12)\n" + + "\x10csharp_namespace\x18% \x01(\tR\x0fcsharpNamespace\x12!\n" + + "\fswift_prefix\x18' \x01(\tR\vswiftPrefix\x12(\n" + + "\x10php_class_prefix\x18( \x01(\tR\x0ephpClassPrefix\x12#\n" + + "\rphp_namespace\x18) \x01(\tR\fphpNamespace\x124\n" + + "\x16php_metadata_namespace\x18, \x01(\tR\x14phpMetadataNamespace\x12!\n" + + "\fruby_package\x18- \x01(\tR\vrubyPackage\x127\n" + + "\bfeatures\x182 \x01(\v2\x1b.google.protobuf.FeatureSetR\bfeatures\x12X\n" + + "\x14uninterpreted_option\x18\xe7\a \x03(\v2$.google.protobuf.UninterpretedOptionR\x13uninterpretedOption\":\n" + + "\fOptimizeMode\x12\t\n" + + "\x05SPEED\x10\x01\x12\r\n" + + "\tCODE_SIZE\x10\x02\x12\x10\n" + + "\fLITE_RUNTIME\x10\x03*\t\b\xe8\a\x10\x80\x80\x80\x80\x02J\x04\b*\x10+J\x04\b&\x10'R\x14php_generic_services\"\xf4\x03\n" + + "\x0eMessageOptions\x12<\n" + + "\x17message_set_wire_format\x18\x01 \x01(\b:\x05falseR\x14messageSetWireFormat\x12L\n" + + "\x1fno_standard_descriptor_accessor\x18\x02 \x01(\b:\x05falseR\x1cnoStandardDescriptorAccessor\x12%\n" + + "\n" + + "deprecated\x18\x03 \x01(\b:\x05falseR\n" + + "deprecated\x12\x1b\n" + + "\tmap_entry\x18\a \x01(\bR\bmapEntry\x12V\n" + + "&deprecated_legacy_json_field_conflicts\x18\v \x01(\bB\x02\x18\x01R\"deprecatedLegacyJsonFieldConflicts\x127\n" + + "\bfeatures\x18\f \x01(\v2\x1b.google.protobuf.FeatureSetR\bfeatures\x12X\n" + + "\x14uninterpreted_option\x18\xe7\a \x03(\v2$.google.protobuf.UninterpretedOptionR\x13uninterpretedOption*\t\b\xe8\a\x10\x80\x80\x80\x80\x02J\x04\b\x04\x10\x05J\x04\b\x05\x10\x06J\x04\b\x06\x10\aJ\x04\b\b\x10\tJ\x04\b\t\x10\n" + + "\"\x9d\r\n" + + "\fFieldOptions\x12A\n" + + "\x05ctype\x18\x01 \x01(\x0e2#.google.protobuf.FieldOptions.CType:\x06STRINGR\x05ctype\x12\x16\n" + + "\x06packed\x18\x02 \x01(\bR\x06packed\x12G\n" + + "\x06jstype\x18\x06 \x01(\x0e2$.google.protobuf.FieldOptions.JSType:\tJS_NORMALR\x06jstype\x12\x19\n" + + "\x04lazy\x18\x05 \x01(\b:\x05falseR\x04lazy\x12.\n" + + "\x0funverified_lazy\x18\x0f \x01(\b:\x05falseR\x0eunverifiedLazy\x12%\n" + + "\n" + + "deprecated\x18\x03 \x01(\b:\x05falseR\n" + + "deprecated\x12\x19\n" + + "\x04weak\x18\n" + + " \x01(\b:\x05falseR\x04weak\x12(\n" + + "\fdebug_redact\x18\x10 \x01(\b:\x05falseR\vdebugRedact\x12K\n" + + "\tretention\x18\x11 \x01(\x0e2-.google.protobuf.FieldOptions.OptionRetentionR\tretention\x12H\n" + + "\atargets\x18\x13 \x03(\x0e2..google.protobuf.FieldOptions.OptionTargetTypeR\atargets\x12W\n" + + "\x10edition_defaults\x18\x14 \x03(\v2,.google.protobuf.FieldOptions.EditionDefaultR\x0feditionDefaults\x127\n" + + "\bfeatures\x18\x15 \x01(\v2\x1b.google.protobuf.FeatureSetR\bfeatures\x12U\n" + + "\x0ffeature_support\x18\x16 \x01(\v2,.google.protobuf.FieldOptions.FeatureSupportR\x0efeatureSupport\x12X\n" + + "\x14uninterpreted_option\x18\xe7\a \x03(\v2$.google.protobuf.UninterpretedOptionR\x13uninterpretedOption\x1aZ\n" + + "\x0eEditionDefault\x122\n" + + "\aedition\x18\x03 \x01(\x0e2\x18.google.protobuf.EditionR\aedition\x12\x14\n" + + "\x05value\x18\x02 \x01(\tR\x05value\x1a\x96\x02\n" + + "\x0eFeatureSupport\x12G\n" + + "\x12edition_introduced\x18\x01 \x01(\x0e2\x18.google.protobuf.EditionR\x11editionIntroduced\x12G\n" + + "\x12edition_deprecated\x18\x02 \x01(\x0e2\x18.google.protobuf.EditionR\x11editionDeprecated\x12/\n" + + "\x13deprecation_warning\x18\x03 \x01(\tR\x12deprecationWarning\x12A\n" + + "\x0fedition_removed\x18\x04 \x01(\x0e2\x18.google.protobuf.EditionR\x0eeditionRemoved\"/\n" + + "\x05CType\x12\n" + + "\n" + + "\x06STRING\x10\x00\x12\b\n" + + "\x04CORD\x10\x01\x12\x10\n" + + "\fSTRING_PIECE\x10\x02\"5\n" + + "\x06JSType\x12\r\n" + + "\tJS_NORMAL\x10\x00\x12\r\n" + + "\tJS_STRING\x10\x01\x12\r\n" + + "\tJS_NUMBER\x10\x02\"U\n" + + "\x0fOptionRetention\x12\x15\n" + + "\x11RETENTION_UNKNOWN\x10\x00\x12\x15\n" + + "\x11RETENTION_RUNTIME\x10\x01\x12\x14\n" + + "\x10RETENTION_SOURCE\x10\x02\"\x8c\x02\n" + + "\x10OptionTargetType\x12\x17\n" + + "\x13TARGET_TYPE_UNKNOWN\x10\x00\x12\x14\n" + + "\x10TARGET_TYPE_FILE\x10\x01\x12\x1f\n" + + "\x1bTARGET_TYPE_EXTENSION_RANGE\x10\x02\x12\x17\n" + + "\x13TARGET_TYPE_MESSAGE\x10\x03\x12\x15\n" + + "\x11TARGET_TYPE_FIELD\x10\x04\x12\x15\n" + + "\x11TARGET_TYPE_ONEOF\x10\x05\x12\x14\n" + + "\x10TARGET_TYPE_ENUM\x10\x06\x12\x1a\n" + + "\x16TARGET_TYPE_ENUM_ENTRY\x10\a\x12\x17\n" + + "\x13TARGET_TYPE_SERVICE\x10\b\x12\x16\n" + + "\x12TARGET_TYPE_METHOD\x10\t*\t\b\xe8\a\x10\x80\x80\x80\x80\x02J\x04\b\x04\x10\x05J\x04\b\x12\x10\x13\"\xac\x01\n" + + "\fOneofOptions\x127\n" + + "\bfeatures\x18\x01 \x01(\v2\x1b.google.protobuf.FeatureSetR\bfeatures\x12X\n" + + "\x14uninterpreted_option\x18\xe7\a \x03(\v2$.google.protobuf.UninterpretedOptionR\x13uninterpretedOption*\t\b\xe8\a\x10\x80\x80\x80\x80\x02\"\xd1\x02\n" + + "\vEnumOptions\x12\x1f\n" + + "\vallow_alias\x18\x02 \x01(\bR\n" + + "allowAlias\x12%\n" + + "\n" + + "deprecated\x18\x03 \x01(\b:\x05falseR\n" + + "deprecated\x12V\n" + + "&deprecated_legacy_json_field_conflicts\x18\x06 \x01(\bB\x02\x18\x01R\"deprecatedLegacyJsonFieldConflicts\x127\n" + + "\bfeatures\x18\a \x01(\v2\x1b.google.protobuf.FeatureSetR\bfeatures\x12X\n" + + "\x14uninterpreted_option\x18\xe7\a \x03(\v2$.google.protobuf.UninterpretedOptionR\x13uninterpretedOption*\t\b\xe8\a\x10\x80\x80\x80\x80\x02J\x04\b\x05\x10\x06\"\xd8\x02\n" + + "\x10EnumValueOptions\x12%\n" + + "\n" + + "deprecated\x18\x01 \x01(\b:\x05falseR\n" + + "deprecated\x127\n" + + "\bfeatures\x18\x02 \x01(\v2\x1b.google.protobuf.FeatureSetR\bfeatures\x12(\n" + + "\fdebug_redact\x18\x03 \x01(\b:\x05falseR\vdebugRedact\x12U\n" + + "\x0ffeature_support\x18\x04 \x01(\v2,.google.protobuf.FieldOptions.FeatureSupportR\x0efeatureSupport\x12X\n" + + "\x14uninterpreted_option\x18\xe7\a \x03(\v2$.google.protobuf.UninterpretedOptionR\x13uninterpretedOption*\t\b\xe8\a\x10\x80\x80\x80\x80\x02\"\xd5\x01\n" + + "\x0eServiceOptions\x127\n" + + "\bfeatures\x18\" \x01(\v2\x1b.google.protobuf.FeatureSetR\bfeatures\x12%\n" + + "\n" + + "deprecated\x18! \x01(\b:\x05falseR\n" + + "deprecated\x12X\n" + + "\x14uninterpreted_option\x18\xe7\a \x03(\v2$.google.protobuf.UninterpretedOptionR\x13uninterpretedOption*\t\b\xe8\a\x10\x80\x80\x80\x80\x02\"\x99\x03\n" + + "\rMethodOptions\x12%\n" + + "\n" + + "deprecated\x18! \x01(\b:\x05falseR\n" + + "deprecated\x12q\n" + + "\x11idempotency_level\x18\" \x01(\x0e2/.google.protobuf.MethodOptions.IdempotencyLevel:\x13IDEMPOTENCY_UNKNOWNR\x10idempotencyLevel\x127\n" + + "\bfeatures\x18# \x01(\v2\x1b.google.protobuf.FeatureSetR\bfeatures\x12X\n" + + "\x14uninterpreted_option\x18\xe7\a \x03(\v2$.google.protobuf.UninterpretedOptionR\x13uninterpretedOption\"P\n" + + "\x10IdempotencyLevel\x12\x17\n" + + "\x13IDEMPOTENCY_UNKNOWN\x10\x00\x12\x13\n" + + "\x0fNO_SIDE_EFFECTS\x10\x01\x12\x0e\n" + + "\n" + + "IDEMPOTENT\x10\x02*\t\b\xe8\a\x10\x80\x80\x80\x80\x02\"\x9a\x03\n" + + "\x13UninterpretedOption\x12A\n" + + "\x04name\x18\x02 \x03(\v2-.google.protobuf.UninterpretedOption.NamePartR\x04name\x12)\n" + + "\x10identifier_value\x18\x03 \x01(\tR\x0fidentifierValue\x12,\n" + + "\x12positive_int_value\x18\x04 \x01(\x04R\x10positiveIntValue\x12,\n" + + "\x12negative_int_value\x18\x05 \x01(\x03R\x10negativeIntValue\x12!\n" + + "\fdouble_value\x18\x06 \x01(\x01R\vdoubleValue\x12!\n" + + "\fstring_value\x18\a \x01(\fR\vstringValue\x12'\n" + + "\x0faggregate_value\x18\b \x01(\tR\x0eaggregateValue\x1aJ\n" + + "\bNamePart\x12\x1b\n" + + "\tname_part\x18\x01 \x02(\tR\bnamePart\x12!\n" + + "\fis_extension\x18\x02 \x02(\bR\visExtension\"\xae\f\n" + + "\n" + + "FeatureSet\x12\x91\x01\n" + + "\x0efield_presence\x18\x01 \x01(\x0e2).google.protobuf.FeatureSet.FieldPresenceB?\x88\x01\x01\x98\x01\x04\x98\x01\x01\xa2\x01\r\x12\bEXPLICIT\x18\x84\a\xa2\x01\r\x12\bIMPLICIT\x18\xe7\a\xa2\x01\r\x12\bEXPLICIT\x18\xe8\a\xb2\x01\x03\b\xe8\aR\rfieldPresence\x12l\n" + + "\tenum_type\x18\x02 \x01(\x0e2$.google.protobuf.FeatureSet.EnumTypeB)\x88\x01\x01\x98\x01\x06\x98\x01\x01\xa2\x01\v\x12\x06CLOSED\x18\x84\a\xa2\x01\t\x12\x04OPEN\x18\xe7\a\xb2\x01\x03\b\xe8\aR\benumType\x12\x98\x01\n" + + "\x17repeated_field_encoding\x18\x03 \x01(\x0e21.google.protobuf.FeatureSet.RepeatedFieldEncodingB-\x88\x01\x01\x98\x01\x04\x98\x01\x01\xa2\x01\r\x12\bEXPANDED\x18\x84\a\xa2\x01\v\x12\x06PACKED\x18\xe7\a\xb2\x01\x03\b\xe8\aR\x15repeatedFieldEncoding\x12~\n" + + "\x0futf8_validation\x18\x04 \x01(\x0e2*.google.protobuf.FeatureSet.Utf8ValidationB)\x88\x01\x01\x98\x01\x04\x98\x01\x01\xa2\x01\t\x12\x04NONE\x18\x84\a\xa2\x01\v\x12\x06VERIFY\x18\xe7\a\xb2\x01\x03\b\xe8\aR\x0eutf8Validation\x12~\n" + + "\x10message_encoding\x18\x05 \x01(\x0e2+.google.protobuf.FeatureSet.MessageEncodingB&\x88\x01\x01\x98\x01\x04\x98\x01\x01\xa2\x01\x14\x12\x0fLENGTH_PREFIXED\x18\x84\a\xb2\x01\x03\b\xe8\aR\x0fmessageEncoding\x12\x82\x01\n" + + "\vjson_format\x18\x06 \x01(\x0e2&.google.protobuf.FeatureSet.JsonFormatB9\x88\x01\x01\x98\x01\x03\x98\x01\x06\x98\x01\x01\xa2\x01\x17\x12\x12LEGACY_BEST_EFFORT\x18\x84\a\xa2\x01\n" + + "\x12\x05ALLOW\x18\xe7\a\xb2\x01\x03\b\xe8\aR\n" + + "jsonFormat\x12\xab\x01\n" + + "\x14enforce_naming_style\x18\a \x01(\x0e2..google.protobuf.FeatureSet.EnforceNamingStyleBI\x88\x01\x02\x98\x01\x01\x98\x01\x02\x98\x01\x03\x98\x01\x04\x98\x01\x05\x98\x01\x06\x98\x01\a\x98\x01\b\x98\x01\t\xa2\x01\x11\x12\fSTYLE_LEGACY\x18\x84\a\xa2\x01\x0e\x12\tSTYLE2024\x18\xe9\a\xb2\x01\x03\b\xe9\aR\x12enforceNamingStyle\"\\\n" + + "\rFieldPresence\x12\x1a\n" + + "\x16FIELD_PRESENCE_UNKNOWN\x10\x00\x12\f\n" + + "\bEXPLICIT\x10\x01\x12\f\n" + + "\bIMPLICIT\x10\x02\x12\x13\n" + + "\x0fLEGACY_REQUIRED\x10\x03\"7\n" + + "\bEnumType\x12\x15\n" + + "\x11ENUM_TYPE_UNKNOWN\x10\x00\x12\b\n" + + "\x04OPEN\x10\x01\x12\n" + + "\n" + + "\x06CLOSED\x10\x02\"V\n" + + "\x15RepeatedFieldEncoding\x12#\n" + + "\x1fREPEATED_FIELD_ENCODING_UNKNOWN\x10\x00\x12\n" + + "\n" + + "\x06PACKED\x10\x01\x12\f\n" + + "\bEXPANDED\x10\x02\"I\n" + + "\x0eUtf8Validation\x12\x1b\n" + + "\x17UTF8_VALIDATION_UNKNOWN\x10\x00\x12\n" + + "\n" + + "\x06VERIFY\x10\x02\x12\b\n" + + "\x04NONE\x10\x03\"\x04\b\x01\x10\x01\"S\n" + + "\x0fMessageEncoding\x12\x1c\n" + + "\x18MESSAGE_ENCODING_UNKNOWN\x10\x00\x12\x13\n" + + "\x0fLENGTH_PREFIXED\x10\x01\x12\r\n" + + "\tDELIMITED\x10\x02\"H\n" + + "\n" + + "JsonFormat\x12\x17\n" + + "\x13JSON_FORMAT_UNKNOWN\x10\x00\x12\t\n" + + "\x05ALLOW\x10\x01\x12\x16\n" + + "\x12LEGACY_BEST_EFFORT\x10\x02\"W\n" + + "\x12EnforceNamingStyle\x12 \n" + + "\x1cENFORCE_NAMING_STYLE_UNKNOWN\x10\x00\x12\r\n" + + "\tSTYLE2024\x10\x01\x12\x10\n" + + "\fSTYLE_LEGACY\x10\x02*\x06\b\xe8\a\x10\x8bN*\x06\b\x8bN\x10\x90N*\x06\b\x90N\x10\x91NJ\x06\b\xe7\a\x10\xe8\a\"\xef\x03\n" + + "\x12FeatureSetDefaults\x12X\n" + + "\bdefaults\x18\x01 \x03(\v2<.google.protobuf.FeatureSetDefaults.FeatureSetEditionDefaultR\bdefaults\x12A\n" + + "\x0fminimum_edition\x18\x04 \x01(\x0e2\x18.google.protobuf.EditionR\x0eminimumEdition\x12A\n" + + "\x0fmaximum_edition\x18\x05 \x01(\x0e2\x18.google.protobuf.EditionR\x0emaximumEdition\x1a\xf8\x01\n" + + "\x18FeatureSetEditionDefault\x122\n" + + "\aedition\x18\x03 \x01(\x0e2\x18.google.protobuf.EditionR\aedition\x12N\n" + + "\x14overridable_features\x18\x04 \x01(\v2\x1b.google.protobuf.FeatureSetR\x13overridableFeatures\x12B\n" + + "\x0efixed_features\x18\x05 \x01(\v2\x1b.google.protobuf.FeatureSetR\rfixedFeaturesJ\x04\b\x01\x10\x02J\x04\b\x02\x10\x03R\bfeatures\"\xb5\x02\n" + + "\x0eSourceCodeInfo\x12D\n" + + "\blocation\x18\x01 \x03(\v2(.google.protobuf.SourceCodeInfo.LocationR\blocation\x1a\xce\x01\n" + + "\bLocation\x12\x16\n" + + "\x04path\x18\x01 \x03(\x05B\x02\x10\x01R\x04path\x12\x16\n" + + "\x04span\x18\x02 \x03(\x05B\x02\x10\x01R\x04span\x12)\n" + + "\x10leading_comments\x18\x03 \x01(\tR\x0fleadingComments\x12+\n" + + "\x11trailing_comments\x18\x04 \x01(\tR\x10trailingComments\x12:\n" + + "\x19leading_detached_comments\x18\x06 \x03(\tR\x17leadingDetachedComments*\f\b\x80\xec\xca\xff\x01\x10\x81\xec\xca\xff\x01\"\xd0\x02\n" + + "\x11GeneratedCodeInfo\x12M\n" + + "\n" + + "annotation\x18\x01 \x03(\v2-.google.protobuf.GeneratedCodeInfo.AnnotationR\n" + + "annotation\x1a\xeb\x01\n" + + "\n" + + "Annotation\x12\x16\n" + + "\x04path\x18\x01 \x03(\x05B\x02\x10\x01R\x04path\x12\x1f\n" + + "\vsource_file\x18\x02 \x01(\tR\n" + + "sourceFile\x12\x14\n" + + "\x05begin\x18\x03 \x01(\x05R\x05begin\x12\x10\n" + + "\x03end\x18\x04 \x01(\x05R\x03end\x12R\n" + + "\bsemantic\x18\x05 \x01(\x0e26.google.protobuf.GeneratedCodeInfo.Annotation.SemanticR\bsemantic\"(\n" + + "\bSemantic\x12\b\n" + + "\x04NONE\x10\x00\x12\a\n" + + "\x03SET\x10\x01\x12\t\n" + + "\x05ALIAS\x10\x02*\xa7\x02\n" + + "\aEdition\x12\x13\n" + + "\x0fEDITION_UNKNOWN\x10\x00\x12\x13\n" + + "\x0eEDITION_LEGACY\x10\x84\a\x12\x13\n" + + "\x0eEDITION_PROTO2\x10\xe6\a\x12\x13\n" + + "\x0eEDITION_PROTO3\x10\xe7\a\x12\x11\n" + + "\fEDITION_2023\x10\xe8\a\x12\x11\n" + + "\fEDITION_2024\x10\xe9\a\x12\x17\n" + + "\x13EDITION_1_TEST_ONLY\x10\x01\x12\x17\n" + + "\x13EDITION_2_TEST_ONLY\x10\x02\x12\x1d\n" + + "\x17EDITION_99997_TEST_ONLY\x10\x9d\x8d\x06\x12\x1d\n" + + "\x17EDITION_99998_TEST_ONLY\x10\x9e\x8d\x06\x12\x1d\n" + + "\x17EDITION_99999_TEST_ONLY\x10\x9f\x8d\x06\x12\x13\n" + + "\vEDITION_MAX\x10\xff\xff\xff\xff\aB~\n" + + "\x13com.google.protobufB\x10DescriptorProtosH\x01Z-google.golang.org/protobuf/types/descriptorpb\xf8\x01\x01\xa2\x02\x03GPB\xaa\x02\x1aGoogle.Protobuf.Reflection" var ( file_google_protobuf_descriptor_proto_rawDescOnce sync.Once @@ -5145,7 +4832,7 @@ func file_google_protobuf_descriptor_proto_rawDescGZIP() []byte { return file_google_protobuf_descriptor_proto_rawDescData } -var file_google_protobuf_descriptor_proto_enumTypes = make([]protoimpl.EnumInfo, 17) +var file_google_protobuf_descriptor_proto_enumTypes = make([]protoimpl.EnumInfo, 18) var file_google_protobuf_descriptor_proto_msgTypes = make([]protoimpl.MessageInfo, 33) var file_google_protobuf_descriptor_proto_goTypes = []any{ (Edition)(0), // 0: google.protobuf.Edition @@ -5164,124 +4851,126 @@ var file_google_protobuf_descriptor_proto_goTypes = []any{ (FeatureSet_Utf8Validation)(0), // 13: google.protobuf.FeatureSet.Utf8Validation (FeatureSet_MessageEncoding)(0), // 14: google.protobuf.FeatureSet.MessageEncoding (FeatureSet_JsonFormat)(0), // 15: google.protobuf.FeatureSet.JsonFormat - (GeneratedCodeInfo_Annotation_Semantic)(0), // 16: google.protobuf.GeneratedCodeInfo.Annotation.Semantic - (*FileDescriptorSet)(nil), // 17: google.protobuf.FileDescriptorSet - (*FileDescriptorProto)(nil), // 18: google.protobuf.FileDescriptorProto - (*DescriptorProto)(nil), // 19: google.protobuf.DescriptorProto - (*ExtensionRangeOptions)(nil), // 20: google.protobuf.ExtensionRangeOptions - (*FieldDescriptorProto)(nil), // 21: google.protobuf.FieldDescriptorProto - (*OneofDescriptorProto)(nil), // 22: google.protobuf.OneofDescriptorProto - (*EnumDescriptorProto)(nil), // 23: google.protobuf.EnumDescriptorProto - (*EnumValueDescriptorProto)(nil), // 24: google.protobuf.EnumValueDescriptorProto - (*ServiceDescriptorProto)(nil), // 25: google.protobuf.ServiceDescriptorProto - (*MethodDescriptorProto)(nil), // 26: google.protobuf.MethodDescriptorProto - (*FileOptions)(nil), // 27: google.protobuf.FileOptions - (*MessageOptions)(nil), // 28: google.protobuf.MessageOptions - (*FieldOptions)(nil), // 29: google.protobuf.FieldOptions - (*OneofOptions)(nil), // 30: google.protobuf.OneofOptions - (*EnumOptions)(nil), // 31: google.protobuf.EnumOptions - (*EnumValueOptions)(nil), // 32: google.protobuf.EnumValueOptions - (*ServiceOptions)(nil), // 33: google.protobuf.ServiceOptions - (*MethodOptions)(nil), // 34: google.protobuf.MethodOptions - (*UninterpretedOption)(nil), // 35: google.protobuf.UninterpretedOption - (*FeatureSet)(nil), // 36: google.protobuf.FeatureSet - (*FeatureSetDefaults)(nil), // 37: google.protobuf.FeatureSetDefaults - (*SourceCodeInfo)(nil), // 38: google.protobuf.SourceCodeInfo - (*GeneratedCodeInfo)(nil), // 39: google.protobuf.GeneratedCodeInfo - (*DescriptorProto_ExtensionRange)(nil), // 40: google.protobuf.DescriptorProto.ExtensionRange - (*DescriptorProto_ReservedRange)(nil), // 41: google.protobuf.DescriptorProto.ReservedRange - (*ExtensionRangeOptions_Declaration)(nil), // 42: google.protobuf.ExtensionRangeOptions.Declaration - (*EnumDescriptorProto_EnumReservedRange)(nil), // 43: google.protobuf.EnumDescriptorProto.EnumReservedRange - (*FieldOptions_EditionDefault)(nil), // 44: google.protobuf.FieldOptions.EditionDefault - (*FieldOptions_FeatureSupport)(nil), // 45: google.protobuf.FieldOptions.FeatureSupport - (*UninterpretedOption_NamePart)(nil), // 46: google.protobuf.UninterpretedOption.NamePart - (*FeatureSetDefaults_FeatureSetEditionDefault)(nil), // 47: google.protobuf.FeatureSetDefaults.FeatureSetEditionDefault - (*SourceCodeInfo_Location)(nil), // 48: google.protobuf.SourceCodeInfo.Location - (*GeneratedCodeInfo_Annotation)(nil), // 49: google.protobuf.GeneratedCodeInfo.Annotation + (FeatureSet_EnforceNamingStyle)(0), // 16: google.protobuf.FeatureSet.EnforceNamingStyle + (GeneratedCodeInfo_Annotation_Semantic)(0), // 17: google.protobuf.GeneratedCodeInfo.Annotation.Semantic + (*FileDescriptorSet)(nil), // 18: google.protobuf.FileDescriptorSet + (*FileDescriptorProto)(nil), // 19: google.protobuf.FileDescriptorProto + (*DescriptorProto)(nil), // 20: google.protobuf.DescriptorProto + (*ExtensionRangeOptions)(nil), // 21: google.protobuf.ExtensionRangeOptions + (*FieldDescriptorProto)(nil), // 22: google.protobuf.FieldDescriptorProto + (*OneofDescriptorProto)(nil), // 23: google.protobuf.OneofDescriptorProto + (*EnumDescriptorProto)(nil), // 24: google.protobuf.EnumDescriptorProto + (*EnumValueDescriptorProto)(nil), // 25: google.protobuf.EnumValueDescriptorProto + (*ServiceDescriptorProto)(nil), // 26: google.protobuf.ServiceDescriptorProto + (*MethodDescriptorProto)(nil), // 27: google.protobuf.MethodDescriptorProto + (*FileOptions)(nil), // 28: google.protobuf.FileOptions + (*MessageOptions)(nil), // 29: google.protobuf.MessageOptions + (*FieldOptions)(nil), // 30: google.protobuf.FieldOptions + (*OneofOptions)(nil), // 31: google.protobuf.OneofOptions + (*EnumOptions)(nil), // 32: google.protobuf.EnumOptions + (*EnumValueOptions)(nil), // 33: google.protobuf.EnumValueOptions + (*ServiceOptions)(nil), // 34: google.protobuf.ServiceOptions + (*MethodOptions)(nil), // 35: google.protobuf.MethodOptions + (*UninterpretedOption)(nil), // 36: google.protobuf.UninterpretedOption + (*FeatureSet)(nil), // 37: google.protobuf.FeatureSet + (*FeatureSetDefaults)(nil), // 38: google.protobuf.FeatureSetDefaults + (*SourceCodeInfo)(nil), // 39: google.protobuf.SourceCodeInfo + (*GeneratedCodeInfo)(nil), // 40: google.protobuf.GeneratedCodeInfo + (*DescriptorProto_ExtensionRange)(nil), // 41: google.protobuf.DescriptorProto.ExtensionRange + (*DescriptorProto_ReservedRange)(nil), // 42: google.protobuf.DescriptorProto.ReservedRange + (*ExtensionRangeOptions_Declaration)(nil), // 43: google.protobuf.ExtensionRangeOptions.Declaration + (*EnumDescriptorProto_EnumReservedRange)(nil), // 44: google.protobuf.EnumDescriptorProto.EnumReservedRange + (*FieldOptions_EditionDefault)(nil), // 45: google.protobuf.FieldOptions.EditionDefault + (*FieldOptions_FeatureSupport)(nil), // 46: google.protobuf.FieldOptions.FeatureSupport + (*UninterpretedOption_NamePart)(nil), // 47: google.protobuf.UninterpretedOption.NamePart + (*FeatureSetDefaults_FeatureSetEditionDefault)(nil), // 48: google.protobuf.FeatureSetDefaults.FeatureSetEditionDefault + (*SourceCodeInfo_Location)(nil), // 49: google.protobuf.SourceCodeInfo.Location + (*GeneratedCodeInfo_Annotation)(nil), // 50: google.protobuf.GeneratedCodeInfo.Annotation } var file_google_protobuf_descriptor_proto_depIdxs = []int32{ - 18, // 0: google.protobuf.FileDescriptorSet.file:type_name -> google.protobuf.FileDescriptorProto - 19, // 1: google.protobuf.FileDescriptorProto.message_type:type_name -> google.protobuf.DescriptorProto - 23, // 2: google.protobuf.FileDescriptorProto.enum_type:type_name -> google.protobuf.EnumDescriptorProto - 25, // 3: google.protobuf.FileDescriptorProto.service:type_name -> google.protobuf.ServiceDescriptorProto - 21, // 4: google.protobuf.FileDescriptorProto.extension:type_name -> google.protobuf.FieldDescriptorProto - 27, // 5: google.protobuf.FileDescriptorProto.options:type_name -> google.protobuf.FileOptions - 38, // 6: google.protobuf.FileDescriptorProto.source_code_info:type_name -> google.protobuf.SourceCodeInfo + 19, // 0: google.protobuf.FileDescriptorSet.file:type_name -> google.protobuf.FileDescriptorProto + 20, // 1: google.protobuf.FileDescriptorProto.message_type:type_name -> google.protobuf.DescriptorProto + 24, // 2: google.protobuf.FileDescriptorProto.enum_type:type_name -> google.protobuf.EnumDescriptorProto + 26, // 3: google.protobuf.FileDescriptorProto.service:type_name -> google.protobuf.ServiceDescriptorProto + 22, // 4: google.protobuf.FileDescriptorProto.extension:type_name -> google.protobuf.FieldDescriptorProto + 28, // 5: google.protobuf.FileDescriptorProto.options:type_name -> google.protobuf.FileOptions + 39, // 6: google.protobuf.FileDescriptorProto.source_code_info:type_name -> google.protobuf.SourceCodeInfo 0, // 7: google.protobuf.FileDescriptorProto.edition:type_name -> google.protobuf.Edition - 21, // 8: google.protobuf.DescriptorProto.field:type_name -> google.protobuf.FieldDescriptorProto - 21, // 9: google.protobuf.DescriptorProto.extension:type_name -> google.protobuf.FieldDescriptorProto - 19, // 10: google.protobuf.DescriptorProto.nested_type:type_name -> google.protobuf.DescriptorProto - 23, // 11: google.protobuf.DescriptorProto.enum_type:type_name -> google.protobuf.EnumDescriptorProto - 40, // 12: google.protobuf.DescriptorProto.extension_range:type_name -> google.protobuf.DescriptorProto.ExtensionRange - 22, // 13: google.protobuf.DescriptorProto.oneof_decl:type_name -> google.protobuf.OneofDescriptorProto - 28, // 14: google.protobuf.DescriptorProto.options:type_name -> google.protobuf.MessageOptions - 41, // 15: google.protobuf.DescriptorProto.reserved_range:type_name -> google.protobuf.DescriptorProto.ReservedRange - 35, // 16: google.protobuf.ExtensionRangeOptions.uninterpreted_option:type_name -> google.protobuf.UninterpretedOption - 42, // 17: google.protobuf.ExtensionRangeOptions.declaration:type_name -> google.protobuf.ExtensionRangeOptions.Declaration - 36, // 18: google.protobuf.ExtensionRangeOptions.features:type_name -> google.protobuf.FeatureSet + 22, // 8: google.protobuf.DescriptorProto.field:type_name -> google.protobuf.FieldDescriptorProto + 22, // 9: google.protobuf.DescriptorProto.extension:type_name -> google.protobuf.FieldDescriptorProto + 20, // 10: google.protobuf.DescriptorProto.nested_type:type_name -> google.protobuf.DescriptorProto + 24, // 11: google.protobuf.DescriptorProto.enum_type:type_name -> google.protobuf.EnumDescriptorProto + 41, // 12: google.protobuf.DescriptorProto.extension_range:type_name -> google.protobuf.DescriptorProto.ExtensionRange + 23, // 13: google.protobuf.DescriptorProto.oneof_decl:type_name -> google.protobuf.OneofDescriptorProto + 29, // 14: google.protobuf.DescriptorProto.options:type_name -> google.protobuf.MessageOptions + 42, // 15: google.protobuf.DescriptorProto.reserved_range:type_name -> google.protobuf.DescriptorProto.ReservedRange + 36, // 16: google.protobuf.ExtensionRangeOptions.uninterpreted_option:type_name -> google.protobuf.UninterpretedOption + 43, // 17: google.protobuf.ExtensionRangeOptions.declaration:type_name -> google.protobuf.ExtensionRangeOptions.Declaration + 37, // 18: google.protobuf.ExtensionRangeOptions.features:type_name -> google.protobuf.FeatureSet 1, // 19: google.protobuf.ExtensionRangeOptions.verification:type_name -> google.protobuf.ExtensionRangeOptions.VerificationState 3, // 20: google.protobuf.FieldDescriptorProto.label:type_name -> google.protobuf.FieldDescriptorProto.Label 2, // 21: google.protobuf.FieldDescriptorProto.type:type_name -> google.protobuf.FieldDescriptorProto.Type - 29, // 22: google.protobuf.FieldDescriptorProto.options:type_name -> google.protobuf.FieldOptions - 30, // 23: google.protobuf.OneofDescriptorProto.options:type_name -> google.protobuf.OneofOptions - 24, // 24: google.protobuf.EnumDescriptorProto.value:type_name -> google.protobuf.EnumValueDescriptorProto - 31, // 25: google.protobuf.EnumDescriptorProto.options:type_name -> google.protobuf.EnumOptions - 43, // 26: google.protobuf.EnumDescriptorProto.reserved_range:type_name -> google.protobuf.EnumDescriptorProto.EnumReservedRange - 32, // 27: google.protobuf.EnumValueDescriptorProto.options:type_name -> google.protobuf.EnumValueOptions - 26, // 28: google.protobuf.ServiceDescriptorProto.method:type_name -> google.protobuf.MethodDescriptorProto - 33, // 29: google.protobuf.ServiceDescriptorProto.options:type_name -> google.protobuf.ServiceOptions - 34, // 30: google.protobuf.MethodDescriptorProto.options:type_name -> google.protobuf.MethodOptions + 30, // 22: google.protobuf.FieldDescriptorProto.options:type_name -> google.protobuf.FieldOptions + 31, // 23: google.protobuf.OneofDescriptorProto.options:type_name -> google.protobuf.OneofOptions + 25, // 24: google.protobuf.EnumDescriptorProto.value:type_name -> google.protobuf.EnumValueDescriptorProto + 32, // 25: google.protobuf.EnumDescriptorProto.options:type_name -> google.protobuf.EnumOptions + 44, // 26: google.protobuf.EnumDescriptorProto.reserved_range:type_name -> google.protobuf.EnumDescriptorProto.EnumReservedRange + 33, // 27: google.protobuf.EnumValueDescriptorProto.options:type_name -> google.protobuf.EnumValueOptions + 27, // 28: google.protobuf.ServiceDescriptorProto.method:type_name -> google.protobuf.MethodDescriptorProto + 34, // 29: google.protobuf.ServiceDescriptorProto.options:type_name -> google.protobuf.ServiceOptions + 35, // 30: google.protobuf.MethodDescriptorProto.options:type_name -> google.protobuf.MethodOptions 4, // 31: google.protobuf.FileOptions.optimize_for:type_name -> google.protobuf.FileOptions.OptimizeMode - 36, // 32: google.protobuf.FileOptions.features:type_name -> google.protobuf.FeatureSet - 35, // 33: google.protobuf.FileOptions.uninterpreted_option:type_name -> google.protobuf.UninterpretedOption - 36, // 34: google.protobuf.MessageOptions.features:type_name -> google.protobuf.FeatureSet - 35, // 35: google.protobuf.MessageOptions.uninterpreted_option:type_name -> google.protobuf.UninterpretedOption + 37, // 32: google.protobuf.FileOptions.features:type_name -> google.protobuf.FeatureSet + 36, // 33: google.protobuf.FileOptions.uninterpreted_option:type_name -> google.protobuf.UninterpretedOption + 37, // 34: google.protobuf.MessageOptions.features:type_name -> google.protobuf.FeatureSet + 36, // 35: google.protobuf.MessageOptions.uninterpreted_option:type_name -> google.protobuf.UninterpretedOption 5, // 36: google.protobuf.FieldOptions.ctype:type_name -> google.protobuf.FieldOptions.CType 6, // 37: google.protobuf.FieldOptions.jstype:type_name -> google.protobuf.FieldOptions.JSType 7, // 38: google.protobuf.FieldOptions.retention:type_name -> google.protobuf.FieldOptions.OptionRetention 8, // 39: google.protobuf.FieldOptions.targets:type_name -> google.protobuf.FieldOptions.OptionTargetType - 44, // 40: google.protobuf.FieldOptions.edition_defaults:type_name -> google.protobuf.FieldOptions.EditionDefault - 36, // 41: google.protobuf.FieldOptions.features:type_name -> google.protobuf.FeatureSet - 45, // 42: google.protobuf.FieldOptions.feature_support:type_name -> google.protobuf.FieldOptions.FeatureSupport - 35, // 43: google.protobuf.FieldOptions.uninterpreted_option:type_name -> google.protobuf.UninterpretedOption - 36, // 44: google.protobuf.OneofOptions.features:type_name -> google.protobuf.FeatureSet - 35, // 45: google.protobuf.OneofOptions.uninterpreted_option:type_name -> google.protobuf.UninterpretedOption - 36, // 46: google.protobuf.EnumOptions.features:type_name -> google.protobuf.FeatureSet - 35, // 47: google.protobuf.EnumOptions.uninterpreted_option:type_name -> google.protobuf.UninterpretedOption - 36, // 48: google.protobuf.EnumValueOptions.features:type_name -> google.protobuf.FeatureSet - 45, // 49: google.protobuf.EnumValueOptions.feature_support:type_name -> google.protobuf.FieldOptions.FeatureSupport - 35, // 50: google.protobuf.EnumValueOptions.uninterpreted_option:type_name -> google.protobuf.UninterpretedOption - 36, // 51: google.protobuf.ServiceOptions.features:type_name -> google.protobuf.FeatureSet - 35, // 52: google.protobuf.ServiceOptions.uninterpreted_option:type_name -> google.protobuf.UninterpretedOption + 45, // 40: google.protobuf.FieldOptions.edition_defaults:type_name -> google.protobuf.FieldOptions.EditionDefault + 37, // 41: google.protobuf.FieldOptions.features:type_name -> google.protobuf.FeatureSet + 46, // 42: google.protobuf.FieldOptions.feature_support:type_name -> google.protobuf.FieldOptions.FeatureSupport + 36, // 43: google.protobuf.FieldOptions.uninterpreted_option:type_name -> google.protobuf.UninterpretedOption + 37, // 44: google.protobuf.OneofOptions.features:type_name -> google.protobuf.FeatureSet + 36, // 45: google.protobuf.OneofOptions.uninterpreted_option:type_name -> google.protobuf.UninterpretedOption + 37, // 46: google.protobuf.EnumOptions.features:type_name -> google.protobuf.FeatureSet + 36, // 47: google.protobuf.EnumOptions.uninterpreted_option:type_name -> google.protobuf.UninterpretedOption + 37, // 48: google.protobuf.EnumValueOptions.features:type_name -> google.protobuf.FeatureSet + 46, // 49: google.protobuf.EnumValueOptions.feature_support:type_name -> google.protobuf.FieldOptions.FeatureSupport + 36, // 50: google.protobuf.EnumValueOptions.uninterpreted_option:type_name -> google.protobuf.UninterpretedOption + 37, // 51: google.protobuf.ServiceOptions.features:type_name -> google.protobuf.FeatureSet + 36, // 52: google.protobuf.ServiceOptions.uninterpreted_option:type_name -> google.protobuf.UninterpretedOption 9, // 53: google.protobuf.MethodOptions.idempotency_level:type_name -> google.protobuf.MethodOptions.IdempotencyLevel - 36, // 54: google.protobuf.MethodOptions.features:type_name -> google.protobuf.FeatureSet - 35, // 55: google.protobuf.MethodOptions.uninterpreted_option:type_name -> google.protobuf.UninterpretedOption - 46, // 56: google.protobuf.UninterpretedOption.name:type_name -> google.protobuf.UninterpretedOption.NamePart + 37, // 54: google.protobuf.MethodOptions.features:type_name -> google.protobuf.FeatureSet + 36, // 55: google.protobuf.MethodOptions.uninterpreted_option:type_name -> google.protobuf.UninterpretedOption + 47, // 56: google.protobuf.UninterpretedOption.name:type_name -> google.protobuf.UninterpretedOption.NamePart 10, // 57: google.protobuf.FeatureSet.field_presence:type_name -> google.protobuf.FeatureSet.FieldPresence 11, // 58: google.protobuf.FeatureSet.enum_type:type_name -> google.protobuf.FeatureSet.EnumType 12, // 59: google.protobuf.FeatureSet.repeated_field_encoding:type_name -> google.protobuf.FeatureSet.RepeatedFieldEncoding 13, // 60: google.protobuf.FeatureSet.utf8_validation:type_name -> google.protobuf.FeatureSet.Utf8Validation 14, // 61: google.protobuf.FeatureSet.message_encoding:type_name -> google.protobuf.FeatureSet.MessageEncoding 15, // 62: google.protobuf.FeatureSet.json_format:type_name -> google.protobuf.FeatureSet.JsonFormat - 47, // 63: google.protobuf.FeatureSetDefaults.defaults:type_name -> google.protobuf.FeatureSetDefaults.FeatureSetEditionDefault - 0, // 64: google.protobuf.FeatureSetDefaults.minimum_edition:type_name -> google.protobuf.Edition - 0, // 65: google.protobuf.FeatureSetDefaults.maximum_edition:type_name -> google.protobuf.Edition - 48, // 66: google.protobuf.SourceCodeInfo.location:type_name -> google.protobuf.SourceCodeInfo.Location - 49, // 67: google.protobuf.GeneratedCodeInfo.annotation:type_name -> google.protobuf.GeneratedCodeInfo.Annotation - 20, // 68: google.protobuf.DescriptorProto.ExtensionRange.options:type_name -> google.protobuf.ExtensionRangeOptions - 0, // 69: google.protobuf.FieldOptions.EditionDefault.edition:type_name -> google.protobuf.Edition - 0, // 70: google.protobuf.FieldOptions.FeatureSupport.edition_introduced:type_name -> google.protobuf.Edition - 0, // 71: google.protobuf.FieldOptions.FeatureSupport.edition_deprecated:type_name -> google.protobuf.Edition - 0, // 72: google.protobuf.FieldOptions.FeatureSupport.edition_removed:type_name -> google.protobuf.Edition - 0, // 73: google.protobuf.FeatureSetDefaults.FeatureSetEditionDefault.edition:type_name -> google.protobuf.Edition - 36, // 74: google.protobuf.FeatureSetDefaults.FeatureSetEditionDefault.overridable_features:type_name -> google.protobuf.FeatureSet - 36, // 75: google.protobuf.FeatureSetDefaults.FeatureSetEditionDefault.fixed_features:type_name -> google.protobuf.FeatureSet - 16, // 76: google.protobuf.GeneratedCodeInfo.Annotation.semantic:type_name -> google.protobuf.GeneratedCodeInfo.Annotation.Semantic - 77, // [77:77] is the sub-list for method output_type - 77, // [77:77] is the sub-list for method input_type - 77, // [77:77] is the sub-list for extension type_name - 77, // [77:77] is the sub-list for extension extendee - 0, // [0:77] is the sub-list for field type_name + 16, // 63: google.protobuf.FeatureSet.enforce_naming_style:type_name -> google.protobuf.FeatureSet.EnforceNamingStyle + 48, // 64: google.protobuf.FeatureSetDefaults.defaults:type_name -> google.protobuf.FeatureSetDefaults.FeatureSetEditionDefault + 0, // 65: google.protobuf.FeatureSetDefaults.minimum_edition:type_name -> google.protobuf.Edition + 0, // 66: google.protobuf.FeatureSetDefaults.maximum_edition:type_name -> google.protobuf.Edition + 49, // 67: google.protobuf.SourceCodeInfo.location:type_name -> google.protobuf.SourceCodeInfo.Location + 50, // 68: google.protobuf.GeneratedCodeInfo.annotation:type_name -> google.protobuf.GeneratedCodeInfo.Annotation + 21, // 69: google.protobuf.DescriptorProto.ExtensionRange.options:type_name -> google.protobuf.ExtensionRangeOptions + 0, // 70: google.protobuf.FieldOptions.EditionDefault.edition:type_name -> google.protobuf.Edition + 0, // 71: google.protobuf.FieldOptions.FeatureSupport.edition_introduced:type_name -> google.protobuf.Edition + 0, // 72: google.protobuf.FieldOptions.FeatureSupport.edition_deprecated:type_name -> google.protobuf.Edition + 0, // 73: google.protobuf.FieldOptions.FeatureSupport.edition_removed:type_name -> google.protobuf.Edition + 0, // 74: google.protobuf.FeatureSetDefaults.FeatureSetEditionDefault.edition:type_name -> google.protobuf.Edition + 37, // 75: google.protobuf.FeatureSetDefaults.FeatureSetEditionDefault.overridable_features:type_name -> google.protobuf.FeatureSet + 37, // 76: google.protobuf.FeatureSetDefaults.FeatureSetEditionDefault.fixed_features:type_name -> google.protobuf.FeatureSet + 17, // 77: google.protobuf.GeneratedCodeInfo.Annotation.semantic:type_name -> google.protobuf.GeneratedCodeInfo.Annotation.Semantic + 78, // [78:78] is the sub-list for method output_type + 78, // [78:78] is the sub-list for method input_type + 78, // [78:78] is the sub-list for extension type_name + 78, // [78:78] is the sub-list for extension extendee + 0, // [0:78] is the sub-list for field type_name } func init() { file_google_protobuf_descriptor_proto_init() } @@ -5294,7 +4983,7 @@ func file_google_protobuf_descriptor_proto_init() { File: protoimpl.DescBuilder{ GoPackagePath: reflect.TypeOf(x{}).PkgPath(), RawDescriptor: unsafe.Slice(unsafe.StringData(file_google_protobuf_descriptor_proto_rawDesc), len(file_google_protobuf_descriptor_proto_rawDesc)), - NumEnums: 17, + NumEnums: 18, NumMessages: 33, NumExtensions: 0, NumServices: 0, diff --git a/vendor/google.golang.org/protobuf/types/gofeaturespb/go_features.pb.go b/vendor/google.golang.org/protobuf/types/gofeaturespb/go_features.pb.go index 28d24bad79e..37e712b6b72 100644 --- a/vendor/google.golang.org/protobuf/types/gofeaturespb/go_features.pb.go +++ b/vendor/google.golang.org/protobuf/types/gofeaturespb/go_features.pb.go @@ -228,63 +228,29 @@ var ( var File_google_protobuf_go_features_proto protoreflect.FileDescriptor -var file_google_protobuf_go_features_proto_rawDesc = string([]byte{ - 0x0a, 0x21, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2f, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, - 0x66, 0x2f, 0x67, 0x6f, 0x5f, 0x66, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x73, 0x2e, 0x70, 0x72, - 0x6f, 0x74, 0x6f, 0x12, 0x02, 0x70, 0x62, 0x1a, 0x20, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2f, - 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2f, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, - 0x74, 0x6f, 0x72, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x22, 0xab, 0x05, 0x0a, 0x0a, 0x47, 0x6f, - 0x46, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x73, 0x12, 0xbe, 0x01, 0x0a, 0x1a, 0x6c, 0x65, 0x67, - 0x61, 0x63, 0x79, 0x5f, 0x75, 0x6e, 0x6d, 0x61, 0x72, 0x73, 0x68, 0x61, 0x6c, 0x5f, 0x6a, 0x73, - 0x6f, 0x6e, 0x5f, 0x65, 0x6e, 0x75, 0x6d, 0x18, 0x01, 0x20, 0x01, 0x28, 0x08, 0x42, 0x80, 0x01, - 0x88, 0x01, 0x01, 0x98, 0x01, 0x06, 0x98, 0x01, 0x01, 0xa2, 0x01, 0x09, 0x12, 0x04, 0x74, 0x72, - 0x75, 0x65, 0x18, 0x84, 0x07, 0xa2, 0x01, 0x0a, 0x12, 0x05, 0x66, 0x61, 0x6c, 0x73, 0x65, 0x18, - 0xe7, 0x07, 0xb2, 0x01, 0x5b, 0x08, 0xe8, 0x07, 0x10, 0xe8, 0x07, 0x1a, 0x53, 0x54, 0x68, 0x65, - 0x20, 0x6c, 0x65, 0x67, 0x61, 0x63, 0x79, 0x20, 0x55, 0x6e, 0x6d, 0x61, 0x72, 0x73, 0x68, 0x61, - 0x6c, 0x4a, 0x53, 0x4f, 0x4e, 0x20, 0x41, 0x50, 0x49, 0x20, 0x69, 0x73, 0x20, 0x64, 0x65, 0x70, - 0x72, 0x65, 0x63, 0x61, 0x74, 0x65, 0x64, 0x20, 0x61, 0x6e, 0x64, 0x20, 0x77, 0x69, 0x6c, 0x6c, - 0x20, 0x62, 0x65, 0x20, 0x72, 0x65, 0x6d, 0x6f, 0x76, 0x65, 0x64, 0x20, 0x69, 0x6e, 0x20, 0x61, - 0x20, 0x66, 0x75, 0x74, 0x75, 0x72, 0x65, 0x20, 0x65, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x2e, - 0x52, 0x17, 0x6c, 0x65, 0x67, 0x61, 0x63, 0x79, 0x55, 0x6e, 0x6d, 0x61, 0x72, 0x73, 0x68, 0x61, - 0x6c, 0x4a, 0x73, 0x6f, 0x6e, 0x45, 0x6e, 0x75, 0x6d, 0x12, 0x74, 0x0a, 0x09, 0x61, 0x70, 0x69, - 0x5f, 0x6c, 0x65, 0x76, 0x65, 0x6c, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x17, 0x2e, 0x70, - 0x62, 0x2e, 0x47, 0x6f, 0x46, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x73, 0x2e, 0x41, 0x50, 0x49, - 0x4c, 0x65, 0x76, 0x65, 0x6c, 0x42, 0x3e, 0x88, 0x01, 0x01, 0x98, 0x01, 0x03, 0x98, 0x01, 0x01, - 0xa2, 0x01, 0x1a, 0x12, 0x15, 0x41, 0x50, 0x49, 0x5f, 0x4c, 0x45, 0x56, 0x45, 0x4c, 0x5f, 0x55, - 0x4e, 0x53, 0x50, 0x45, 0x43, 0x49, 0x46, 0x49, 0x45, 0x44, 0x18, 0x84, 0x07, 0xa2, 0x01, 0x0f, - 0x12, 0x0a, 0x41, 0x50, 0x49, 0x5f, 0x4f, 0x50, 0x41, 0x51, 0x55, 0x45, 0x18, 0xe9, 0x07, 0xb2, - 0x01, 0x03, 0x08, 0xe8, 0x07, 0x52, 0x08, 0x61, 0x70, 0x69, 0x4c, 0x65, 0x76, 0x65, 0x6c, 0x12, - 0x7c, 0x0a, 0x11, 0x73, 0x74, 0x72, 0x69, 0x70, 0x5f, 0x65, 0x6e, 0x75, 0x6d, 0x5f, 0x70, 0x72, - 0x65, 0x66, 0x69, 0x78, 0x18, 0x03, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x1e, 0x2e, 0x70, 0x62, 0x2e, - 0x47, 0x6f, 0x46, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x73, 0x2e, 0x53, 0x74, 0x72, 0x69, 0x70, - 0x45, 0x6e, 0x75, 0x6d, 0x50, 0x72, 0x65, 0x66, 0x69, 0x78, 0x42, 0x30, 0x88, 0x01, 0x01, 0x98, - 0x01, 0x06, 0x98, 0x01, 0x07, 0x98, 0x01, 0x01, 0xa2, 0x01, 0x1b, 0x12, 0x16, 0x53, 0x54, 0x52, - 0x49, 0x50, 0x5f, 0x45, 0x4e, 0x55, 0x4d, 0x5f, 0x50, 0x52, 0x45, 0x46, 0x49, 0x58, 0x5f, 0x4b, - 0x45, 0x45, 0x50, 0x18, 0x84, 0x07, 0xb2, 0x01, 0x03, 0x08, 0xe9, 0x07, 0x52, 0x0f, 0x73, 0x74, - 0x72, 0x69, 0x70, 0x45, 0x6e, 0x75, 0x6d, 0x50, 0x72, 0x65, 0x66, 0x69, 0x78, 0x22, 0x53, 0x0a, - 0x08, 0x41, 0x50, 0x49, 0x4c, 0x65, 0x76, 0x65, 0x6c, 0x12, 0x19, 0x0a, 0x15, 0x41, 0x50, 0x49, - 0x5f, 0x4c, 0x45, 0x56, 0x45, 0x4c, 0x5f, 0x55, 0x4e, 0x53, 0x50, 0x45, 0x43, 0x49, 0x46, 0x49, - 0x45, 0x44, 0x10, 0x00, 0x12, 0x0c, 0x0a, 0x08, 0x41, 0x50, 0x49, 0x5f, 0x4f, 0x50, 0x45, 0x4e, - 0x10, 0x01, 0x12, 0x0e, 0x0a, 0x0a, 0x41, 0x50, 0x49, 0x5f, 0x48, 0x59, 0x42, 0x52, 0x49, 0x44, - 0x10, 0x02, 0x12, 0x0e, 0x0a, 0x0a, 0x41, 0x50, 0x49, 0x5f, 0x4f, 0x50, 0x41, 0x51, 0x55, 0x45, - 0x10, 0x03, 0x22, 0x92, 0x01, 0x0a, 0x0f, 0x53, 0x74, 0x72, 0x69, 0x70, 0x45, 0x6e, 0x75, 0x6d, - 0x50, 0x72, 0x65, 0x66, 0x69, 0x78, 0x12, 0x21, 0x0a, 0x1d, 0x53, 0x54, 0x52, 0x49, 0x50, 0x5f, - 0x45, 0x4e, 0x55, 0x4d, 0x5f, 0x50, 0x52, 0x45, 0x46, 0x49, 0x58, 0x5f, 0x55, 0x4e, 0x53, 0x50, - 0x45, 0x43, 0x49, 0x46, 0x49, 0x45, 0x44, 0x10, 0x00, 0x12, 0x1a, 0x0a, 0x16, 0x53, 0x54, 0x52, - 0x49, 0x50, 0x5f, 0x45, 0x4e, 0x55, 0x4d, 0x5f, 0x50, 0x52, 0x45, 0x46, 0x49, 0x58, 0x5f, 0x4b, - 0x45, 0x45, 0x50, 0x10, 0x01, 0x12, 0x23, 0x0a, 0x1f, 0x53, 0x54, 0x52, 0x49, 0x50, 0x5f, 0x45, - 0x4e, 0x55, 0x4d, 0x5f, 0x50, 0x52, 0x45, 0x46, 0x49, 0x58, 0x5f, 0x47, 0x45, 0x4e, 0x45, 0x52, - 0x41, 0x54, 0x45, 0x5f, 0x42, 0x4f, 0x54, 0x48, 0x10, 0x02, 0x12, 0x1b, 0x0a, 0x17, 0x53, 0x54, - 0x52, 0x49, 0x50, 0x5f, 0x45, 0x4e, 0x55, 0x4d, 0x5f, 0x50, 0x52, 0x45, 0x46, 0x49, 0x58, 0x5f, - 0x53, 0x54, 0x52, 0x49, 0x50, 0x10, 0x03, 0x3a, 0x3c, 0x0a, 0x02, 0x67, 0x6f, 0x12, 0x1b, 0x2e, - 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, - 0x46, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x53, 0x65, 0x74, 0x18, 0xea, 0x07, 0x20, 0x01, 0x28, - 0x0b, 0x32, 0x0e, 0x2e, 0x70, 0x62, 0x2e, 0x47, 0x6f, 0x46, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, - 0x73, 0x52, 0x02, 0x67, 0x6f, 0x42, 0x2f, 0x5a, 0x2d, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, - 0x67, 0x6f, 0x6c, 0x61, 0x6e, 0x67, 0x2e, 0x6f, 0x72, 0x67, 0x2f, 0x70, 0x72, 0x6f, 0x74, 0x6f, - 0x62, 0x75, 0x66, 0x2f, 0x74, 0x79, 0x70, 0x65, 0x73, 0x2f, 0x67, 0x6f, 0x66, 0x65, 0x61, 0x74, - 0x75, 0x72, 0x65, 0x73, 0x70, 0x62, -}) +const file_google_protobuf_go_features_proto_rawDesc = "" + + "\n" + + "!google/protobuf/go_features.proto\x12\x02pb\x1a google/protobuf/descriptor.proto\"\xab\x05\n" + + "\n" + + "GoFeatures\x12\xbe\x01\n" + + "\x1alegacy_unmarshal_json_enum\x18\x01 \x01(\bB\x80\x01\x88\x01\x01\x98\x01\x06\x98\x01\x01\xa2\x01\t\x12\x04true\x18\x84\a\xa2\x01\n" + + "\x12\x05false\x18\xe7\a\xb2\x01[\b\xe8\a\x10\xe8\a\x1aSThe legacy UnmarshalJSON API is deprecated and will be removed in a future edition.R\x17legacyUnmarshalJsonEnum\x12t\n" + + "\tapi_level\x18\x02 \x01(\x0e2\x17.pb.GoFeatures.APILevelB>\x88\x01\x01\x98\x01\x03\x98\x01\x01\xa2\x01\x1a\x12\x15API_LEVEL_UNSPECIFIED\x18\x84\a\xa2\x01\x0f\x12\n" + + "API_OPAQUE\x18\xe9\a\xb2\x01\x03\b\xe8\aR\bapiLevel\x12|\n" + + "\x11strip_enum_prefix\x18\x03 \x01(\x0e2\x1e.pb.GoFeatures.StripEnumPrefixB0\x88\x01\x01\x98\x01\x06\x98\x01\a\x98\x01\x01\xa2\x01\x1b\x12\x16STRIP_ENUM_PREFIX_KEEP\x18\x84\a\xb2\x01\x03\b\xe9\aR\x0fstripEnumPrefix\"S\n" + + "\bAPILevel\x12\x19\n" + + "\x15API_LEVEL_UNSPECIFIED\x10\x00\x12\f\n" + + "\bAPI_OPEN\x10\x01\x12\x0e\n" + + "\n" + + "API_HYBRID\x10\x02\x12\x0e\n" + + "\n" + + "API_OPAQUE\x10\x03\"\x92\x01\n" + + "\x0fStripEnumPrefix\x12!\n" + + "\x1dSTRIP_ENUM_PREFIX_UNSPECIFIED\x10\x00\x12\x1a\n" + + "\x16STRIP_ENUM_PREFIX_KEEP\x10\x01\x12#\n" + + "\x1fSTRIP_ENUM_PREFIX_GENERATE_BOTH\x10\x02\x12\x1b\n" + + "\x17STRIP_ENUM_PREFIX_STRIP\x10\x03:<\n" + + "\x02go\x12\x1b.google.protobuf.FeatureSet\x18\xea\a \x01(\v2\x0e.pb.GoFeaturesR\x02goB/Z-google.golang.org/protobuf/types/gofeaturespb" var ( file_google_protobuf_go_features_proto_rawDescOnce sync.Once diff --git a/vendor/google.golang.org/protobuf/types/known/anypb/any.pb.go b/vendor/google.golang.org/protobuf/types/known/anypb/any.pb.go index 497da66e91f..1ff0d1494d4 100644 --- a/vendor/google.golang.org/protobuf/types/known/anypb/any.pb.go +++ b/vendor/google.golang.org/protobuf/types/known/anypb/any.pb.go @@ -412,23 +412,13 @@ func (x *Any) GetValue() []byte { var File_google_protobuf_any_proto protoreflect.FileDescriptor -var file_google_protobuf_any_proto_rawDesc = string([]byte{ - 0x0a, 0x19, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2f, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, - 0x66, 0x2f, 0x61, 0x6e, 0x79, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x12, 0x0f, 0x67, 0x6f, 0x6f, - 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x22, 0x36, 0x0a, 0x03, - 0x41, 0x6e, 0x79, 0x12, 0x19, 0x0a, 0x08, 0x74, 0x79, 0x70, 0x65, 0x5f, 0x75, 0x72, 0x6c, 0x18, - 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x07, 0x74, 0x79, 0x70, 0x65, 0x55, 0x72, 0x6c, 0x12, 0x14, - 0x0a, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0c, 0x52, 0x05, 0x76, - 0x61, 0x6c, 0x75, 0x65, 0x42, 0x76, 0x0a, 0x13, 0x63, 0x6f, 0x6d, 0x2e, 0x67, 0x6f, 0x6f, 0x67, - 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x42, 0x08, 0x41, 0x6e, 0x79, - 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x50, 0x01, 0x5a, 0x2c, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, - 0x67, 0x6f, 0x6c, 0x61, 0x6e, 0x67, 0x2e, 0x6f, 0x72, 0x67, 0x2f, 0x70, 0x72, 0x6f, 0x74, 0x6f, - 0x62, 0x75, 0x66, 0x2f, 0x74, 0x79, 0x70, 0x65, 0x73, 0x2f, 0x6b, 0x6e, 0x6f, 0x77, 0x6e, 0x2f, - 0x61, 0x6e, 0x79, 0x70, 0x62, 0xa2, 0x02, 0x03, 0x47, 0x50, 0x42, 0xaa, 0x02, 0x1e, 0x47, 0x6f, - 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x57, 0x65, - 0x6c, 0x6c, 0x4b, 0x6e, 0x6f, 0x77, 0x6e, 0x54, 0x79, 0x70, 0x65, 0x73, 0x62, 0x06, 0x70, 0x72, - 0x6f, 0x74, 0x6f, 0x33, -}) +const file_google_protobuf_any_proto_rawDesc = "" + + "\n" + + "\x19google/protobuf/any.proto\x12\x0fgoogle.protobuf\"6\n" + + "\x03Any\x12\x19\n" + + "\btype_url\x18\x01 \x01(\tR\atypeUrl\x12\x14\n" + + "\x05value\x18\x02 \x01(\fR\x05valueBv\n" + + "\x13com.google.protobufB\bAnyProtoP\x01Z,google.golang.org/protobuf/types/known/anypb\xa2\x02\x03GPB\xaa\x02\x1eGoogle.Protobuf.WellKnownTypesb\x06proto3" var ( file_google_protobuf_any_proto_rawDescOnce sync.Once diff --git a/vendor/google.golang.org/protobuf/types/known/durationpb/duration.pb.go b/vendor/google.golang.org/protobuf/types/known/durationpb/duration.pb.go index 193880d1813..ca2e7b38f49 100644 --- a/vendor/google.golang.org/protobuf/types/known/durationpb/duration.pb.go +++ b/vendor/google.golang.org/protobuf/types/known/durationpb/duration.pb.go @@ -289,24 +289,13 @@ func (x *Duration) GetNanos() int32 { var File_google_protobuf_duration_proto protoreflect.FileDescriptor -var file_google_protobuf_duration_proto_rawDesc = string([]byte{ - 0x0a, 0x1e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2f, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, - 0x66, 0x2f, 0x64, 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, - 0x12, 0x0f, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, - 0x66, 0x22, 0x3a, 0x0a, 0x08, 0x44, 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x12, 0x18, 0x0a, - 0x07, 0x73, 0x65, 0x63, 0x6f, 0x6e, 0x64, 0x73, 0x18, 0x01, 0x20, 0x01, 0x28, 0x03, 0x52, 0x07, - 0x73, 0x65, 0x63, 0x6f, 0x6e, 0x64, 0x73, 0x12, 0x14, 0x0a, 0x05, 0x6e, 0x61, 0x6e, 0x6f, 0x73, - 0x18, 0x02, 0x20, 0x01, 0x28, 0x05, 0x52, 0x05, 0x6e, 0x61, 0x6e, 0x6f, 0x73, 0x42, 0x83, 0x01, - 0x0a, 0x13, 0x63, 0x6f, 0x6d, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, - 0x74, 0x6f, 0x62, 0x75, 0x66, 0x42, 0x0d, 0x44, 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x50, - 0x72, 0x6f, 0x74, 0x6f, 0x50, 0x01, 0x5a, 0x31, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x67, - 0x6f, 0x6c, 0x61, 0x6e, 0x67, 0x2e, 0x6f, 0x72, 0x67, 0x2f, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, - 0x75, 0x66, 0x2f, 0x74, 0x79, 0x70, 0x65, 0x73, 0x2f, 0x6b, 0x6e, 0x6f, 0x77, 0x6e, 0x2f, 0x64, - 0x75, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x70, 0x62, 0xf8, 0x01, 0x01, 0xa2, 0x02, 0x03, 0x47, - 0x50, 0x42, 0xaa, 0x02, 0x1e, 0x47, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x50, 0x72, 0x6f, 0x74, - 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x57, 0x65, 0x6c, 0x6c, 0x4b, 0x6e, 0x6f, 0x77, 0x6e, 0x54, 0x79, - 0x70, 0x65, 0x73, 0x62, 0x06, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x33, -}) +const file_google_protobuf_duration_proto_rawDesc = "" + + "\n" + + "\x1egoogle/protobuf/duration.proto\x12\x0fgoogle.protobuf\":\n" + + "\bDuration\x12\x18\n" + + "\aseconds\x18\x01 \x01(\x03R\aseconds\x12\x14\n" + + "\x05nanos\x18\x02 \x01(\x05R\x05nanosB\x83\x01\n" + + "\x13com.google.protobufB\rDurationProtoP\x01Z1google.golang.org/protobuf/types/known/durationpb\xf8\x01\x01\xa2\x02\x03GPB\xaa\x02\x1eGoogle.Protobuf.WellKnownTypesb\x06proto3" var ( file_google_protobuf_duration_proto_rawDescOnce sync.Once diff --git a/vendor/google.golang.org/protobuf/types/known/emptypb/empty.pb.go b/vendor/google.golang.org/protobuf/types/known/emptypb/empty.pb.go index a5b8657c4ba..1d7ee3b4766 100644 --- a/vendor/google.golang.org/protobuf/types/known/emptypb/empty.pb.go +++ b/vendor/google.golang.org/protobuf/types/known/emptypb/empty.pb.go @@ -86,20 +86,12 @@ func (*Empty) Descriptor() ([]byte, []int) { var File_google_protobuf_empty_proto protoreflect.FileDescriptor -var file_google_protobuf_empty_proto_rawDesc = string([]byte{ - 0x0a, 0x1b, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2f, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, - 0x66, 0x2f, 0x65, 0x6d, 0x70, 0x74, 0x79, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x12, 0x0f, 0x67, - 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x22, 0x07, - 0x0a, 0x05, 0x45, 0x6d, 0x70, 0x74, 0x79, 0x42, 0x7d, 0x0a, 0x13, 0x63, 0x6f, 0x6d, 0x2e, 0x67, - 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x42, 0x0a, - 0x45, 0x6d, 0x70, 0x74, 0x79, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x50, 0x01, 0x5a, 0x2e, 0x67, 0x6f, - 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x67, 0x6f, 0x6c, 0x61, 0x6e, 0x67, 0x2e, 0x6f, 0x72, 0x67, 0x2f, - 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2f, 0x74, 0x79, 0x70, 0x65, 0x73, 0x2f, 0x6b, - 0x6e, 0x6f, 0x77, 0x6e, 0x2f, 0x65, 0x6d, 0x70, 0x74, 0x79, 0x70, 0x62, 0xf8, 0x01, 0x01, 0xa2, - 0x02, 0x03, 0x47, 0x50, 0x42, 0xaa, 0x02, 0x1e, 0x47, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x50, - 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x57, 0x65, 0x6c, 0x6c, 0x4b, 0x6e, 0x6f, 0x77, - 0x6e, 0x54, 0x79, 0x70, 0x65, 0x73, 0x62, 0x06, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x33, -}) +const file_google_protobuf_empty_proto_rawDesc = "" + + "\n" + + "\x1bgoogle/protobuf/empty.proto\x12\x0fgoogle.protobuf\"\a\n" + + "\x05EmptyB}\n" + + "\x13com.google.protobufB\n" + + "EmptyProtoP\x01Z.google.golang.org/protobuf/types/known/emptypb\xf8\x01\x01\xa2\x02\x03GPB\xaa\x02\x1eGoogle.Protobuf.WellKnownTypesb\x06proto3" var ( file_google_protobuf_empty_proto_rawDescOnce sync.Once diff --git a/vendor/google.golang.org/protobuf/types/known/fieldmaskpb/field_mask.pb.go b/vendor/google.golang.org/protobuf/types/known/fieldmaskpb/field_mask.pb.go index 041feb0f3ec..91ee89a5cd9 100644 --- a/vendor/google.golang.org/protobuf/types/known/fieldmaskpb/field_mask.pb.go +++ b/vendor/google.golang.org/protobuf/types/known/fieldmaskpb/field_mask.pb.go @@ -504,23 +504,12 @@ func (x *FieldMask) GetPaths() []string { var File_google_protobuf_field_mask_proto protoreflect.FileDescriptor -var file_google_protobuf_field_mask_proto_rawDesc = string([]byte{ - 0x0a, 0x20, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2f, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, - 0x66, 0x2f, 0x66, 0x69, 0x65, 0x6c, 0x64, 0x5f, 0x6d, 0x61, 0x73, 0x6b, 0x2e, 0x70, 0x72, 0x6f, - 0x74, 0x6f, 0x12, 0x0f, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, - 0x62, 0x75, 0x66, 0x22, 0x21, 0x0a, 0x09, 0x46, 0x69, 0x65, 0x6c, 0x64, 0x4d, 0x61, 0x73, 0x6b, - 0x12, 0x14, 0x0a, 0x05, 0x70, 0x61, 0x74, 0x68, 0x73, 0x18, 0x01, 0x20, 0x03, 0x28, 0x09, 0x52, - 0x05, 0x70, 0x61, 0x74, 0x68, 0x73, 0x42, 0x85, 0x01, 0x0a, 0x13, 0x63, 0x6f, 0x6d, 0x2e, 0x67, - 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x42, 0x0e, - 0x46, 0x69, 0x65, 0x6c, 0x64, 0x4d, 0x61, 0x73, 0x6b, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x50, 0x01, - 0x5a, 0x32, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x67, 0x6f, 0x6c, 0x61, 0x6e, 0x67, 0x2e, - 0x6f, 0x72, 0x67, 0x2f, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2f, 0x74, 0x79, 0x70, - 0x65, 0x73, 0x2f, 0x6b, 0x6e, 0x6f, 0x77, 0x6e, 0x2f, 0x66, 0x69, 0x65, 0x6c, 0x64, 0x6d, 0x61, - 0x73, 0x6b, 0x70, 0x62, 0xf8, 0x01, 0x01, 0xa2, 0x02, 0x03, 0x47, 0x50, 0x42, 0xaa, 0x02, 0x1e, - 0x47, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, - 0x57, 0x65, 0x6c, 0x6c, 0x4b, 0x6e, 0x6f, 0x77, 0x6e, 0x54, 0x79, 0x70, 0x65, 0x73, 0x62, 0x06, - 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x33, -}) +const file_google_protobuf_field_mask_proto_rawDesc = "" + + "\n" + + " google/protobuf/field_mask.proto\x12\x0fgoogle.protobuf\"!\n" + + "\tFieldMask\x12\x14\n" + + "\x05paths\x18\x01 \x03(\tR\x05pathsB\x85\x01\n" + + "\x13com.google.protobufB\x0eFieldMaskProtoP\x01Z2google.golang.org/protobuf/types/known/fieldmaskpb\xf8\x01\x01\xa2\x02\x03GPB\xaa\x02\x1eGoogle.Protobuf.WellKnownTypesb\x06proto3" var ( file_google_protobuf_field_mask_proto_rawDescOnce sync.Once diff --git a/vendor/google.golang.org/protobuf/types/known/structpb/struct.pb.go b/vendor/google.golang.org/protobuf/types/known/structpb/struct.pb.go index ecdd31ab538..30411b72838 100644 --- a/vendor/google.golang.org/protobuf/types/known/structpb/struct.pb.go +++ b/vendor/google.golang.org/protobuf/types/known/structpb/struct.pb.go @@ -672,55 +672,31 @@ func (x *ListValue) GetValues() []*Value { var File_google_protobuf_struct_proto protoreflect.FileDescriptor -var file_google_protobuf_struct_proto_rawDesc = string([]byte{ - 0x0a, 0x1c, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2f, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, - 0x66, 0x2f, 0x73, 0x74, 0x72, 0x75, 0x63, 0x74, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x12, 0x0f, - 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x22, - 0x98, 0x01, 0x0a, 0x06, 0x53, 0x74, 0x72, 0x75, 0x63, 0x74, 0x12, 0x3b, 0x0a, 0x06, 0x66, 0x69, - 0x65, 0x6c, 0x64, 0x73, 0x18, 0x01, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x23, 0x2e, 0x67, 0x6f, 0x6f, - 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x53, 0x74, 0x72, - 0x75, 0x63, 0x74, 0x2e, 0x46, 0x69, 0x65, 0x6c, 0x64, 0x73, 0x45, 0x6e, 0x74, 0x72, 0x79, 0x52, - 0x06, 0x66, 0x69, 0x65, 0x6c, 0x64, 0x73, 0x1a, 0x51, 0x0a, 0x0b, 0x46, 0x69, 0x65, 0x6c, 0x64, - 0x73, 0x45, 0x6e, 0x74, 0x72, 0x79, 0x12, 0x10, 0x0a, 0x03, 0x6b, 0x65, 0x79, 0x18, 0x01, 0x20, - 0x01, 0x28, 0x09, 0x52, 0x03, 0x6b, 0x65, 0x79, 0x12, 0x2c, 0x0a, 0x05, 0x76, 0x61, 0x6c, 0x75, - 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x16, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, - 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x52, - 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x3a, 0x02, 0x38, 0x01, 0x22, 0xb2, 0x02, 0x0a, 0x05, 0x56, - 0x61, 0x6c, 0x75, 0x65, 0x12, 0x3b, 0x0a, 0x0a, 0x6e, 0x75, 0x6c, 0x6c, 0x5f, 0x76, 0x61, 0x6c, - 0x75, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x0e, 0x32, 0x1a, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, - 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x4e, 0x75, 0x6c, 0x6c, 0x56, - 0x61, 0x6c, 0x75, 0x65, 0x48, 0x00, 0x52, 0x09, 0x6e, 0x75, 0x6c, 0x6c, 0x56, 0x61, 0x6c, 0x75, - 0x65, 0x12, 0x23, 0x0a, 0x0c, 0x6e, 0x75, 0x6d, 0x62, 0x65, 0x72, 0x5f, 0x76, 0x61, 0x6c, 0x75, - 0x65, 0x18, 0x02, 0x20, 0x01, 0x28, 0x01, 0x48, 0x00, 0x52, 0x0b, 0x6e, 0x75, 0x6d, 0x62, 0x65, - 0x72, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x12, 0x23, 0x0a, 0x0c, 0x73, 0x74, 0x72, 0x69, 0x6e, 0x67, - 0x5f, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x03, 0x20, 0x01, 0x28, 0x09, 0x48, 0x00, 0x52, 0x0b, - 0x73, 0x74, 0x72, 0x69, 0x6e, 0x67, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x12, 0x1f, 0x0a, 0x0a, 0x62, - 0x6f, 0x6f, 0x6c, 0x5f, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x04, 0x20, 0x01, 0x28, 0x08, 0x48, - 0x00, 0x52, 0x09, 0x62, 0x6f, 0x6f, 0x6c, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x12, 0x3c, 0x0a, 0x0c, - 0x73, 0x74, 0x72, 0x75, 0x63, 0x74, 0x5f, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x05, 0x20, 0x01, - 0x28, 0x0b, 0x32, 0x17, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, - 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x53, 0x74, 0x72, 0x75, 0x63, 0x74, 0x48, 0x00, 0x52, 0x0b, 0x73, - 0x74, 0x72, 0x75, 0x63, 0x74, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x12, 0x3b, 0x0a, 0x0a, 0x6c, 0x69, - 0x73, 0x74, 0x5f, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x06, 0x20, 0x01, 0x28, 0x0b, 0x32, 0x1a, - 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, - 0x2e, 0x4c, 0x69, 0x73, 0x74, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x48, 0x00, 0x52, 0x09, 0x6c, 0x69, - 0x73, 0x74, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x42, 0x06, 0x0a, 0x04, 0x6b, 0x69, 0x6e, 0x64, 0x22, - 0x3b, 0x0a, 0x09, 0x4c, 0x69, 0x73, 0x74, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x12, 0x2e, 0x0a, 0x06, - 0x76, 0x61, 0x6c, 0x75, 0x65, 0x73, 0x18, 0x01, 0x20, 0x03, 0x28, 0x0b, 0x32, 0x16, 0x2e, 0x67, - 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x56, - 0x61, 0x6c, 0x75, 0x65, 0x52, 0x06, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x73, 0x2a, 0x1b, 0x0a, 0x09, - 0x4e, 0x75, 0x6c, 0x6c, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x12, 0x0e, 0x0a, 0x0a, 0x4e, 0x55, 0x4c, - 0x4c, 0x5f, 0x56, 0x41, 0x4c, 0x55, 0x45, 0x10, 0x00, 0x42, 0x7f, 0x0a, 0x13, 0x63, 0x6f, 0x6d, - 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, - 0x42, 0x0b, 0x53, 0x74, 0x72, 0x75, 0x63, 0x74, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x50, 0x01, 0x5a, - 0x2f, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x67, 0x6f, 0x6c, 0x61, 0x6e, 0x67, 0x2e, 0x6f, - 0x72, 0x67, 0x2f, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2f, 0x74, 0x79, 0x70, 0x65, - 0x73, 0x2f, 0x6b, 0x6e, 0x6f, 0x77, 0x6e, 0x2f, 0x73, 0x74, 0x72, 0x75, 0x63, 0x74, 0x70, 0x62, - 0xf8, 0x01, 0x01, 0xa2, 0x02, 0x03, 0x47, 0x50, 0x42, 0xaa, 0x02, 0x1e, 0x47, 0x6f, 0x6f, 0x67, - 0x6c, 0x65, 0x2e, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x57, 0x65, 0x6c, 0x6c, - 0x4b, 0x6e, 0x6f, 0x77, 0x6e, 0x54, 0x79, 0x70, 0x65, 0x73, 0x62, 0x06, 0x70, 0x72, 0x6f, 0x74, - 0x6f, 0x33, -}) +const file_google_protobuf_struct_proto_rawDesc = "" + + "\n" + + "\x1cgoogle/protobuf/struct.proto\x12\x0fgoogle.protobuf\"\x98\x01\n" + + "\x06Struct\x12;\n" + + "\x06fields\x18\x01 \x03(\v2#.google.protobuf.Struct.FieldsEntryR\x06fields\x1aQ\n" + + "\vFieldsEntry\x12\x10\n" + + "\x03key\x18\x01 \x01(\tR\x03key\x12,\n" + + "\x05value\x18\x02 \x01(\v2\x16.google.protobuf.ValueR\x05value:\x028\x01\"\xb2\x02\n" + + "\x05Value\x12;\n" + + "\n" + + "null_value\x18\x01 \x01(\x0e2\x1a.google.protobuf.NullValueH\x00R\tnullValue\x12#\n" + + "\fnumber_value\x18\x02 \x01(\x01H\x00R\vnumberValue\x12#\n" + + "\fstring_value\x18\x03 \x01(\tH\x00R\vstringValue\x12\x1f\n" + + "\n" + + "bool_value\x18\x04 \x01(\bH\x00R\tboolValue\x12<\n" + + "\fstruct_value\x18\x05 \x01(\v2\x17.google.protobuf.StructH\x00R\vstructValue\x12;\n" + + "\n" + + "list_value\x18\x06 \x01(\v2\x1a.google.protobuf.ListValueH\x00R\tlistValueB\x06\n" + + "\x04kind\";\n" + + "\tListValue\x12.\n" + + "\x06values\x18\x01 \x03(\v2\x16.google.protobuf.ValueR\x06values*\x1b\n" + + "\tNullValue\x12\x0e\n" + + "\n" + + "NULL_VALUE\x10\x00B\x7f\n" + + "\x13com.google.protobufB\vStructProtoP\x01Z/google.golang.org/protobuf/types/known/structpb\xf8\x01\x01\xa2\x02\x03GPB\xaa\x02\x1eGoogle.Protobuf.WellKnownTypesb\x06proto3" var ( file_google_protobuf_struct_proto_rawDescOnce sync.Once diff --git a/vendor/google.golang.org/protobuf/types/known/timestamppb/timestamp.pb.go b/vendor/google.golang.org/protobuf/types/known/timestamppb/timestamp.pb.go index 00ac835c0bb..06d584c14be 100644 --- a/vendor/google.golang.org/protobuf/types/known/timestamppb/timestamp.pb.go +++ b/vendor/google.golang.org/protobuf/types/known/timestamppb/timestamp.pb.go @@ -298,24 +298,13 @@ func (x *Timestamp) GetNanos() int32 { var File_google_protobuf_timestamp_proto protoreflect.FileDescriptor -var file_google_protobuf_timestamp_proto_rawDesc = string([]byte{ - 0x0a, 0x1f, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2f, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, - 0x66, 0x2f, 0x74, 0x69, 0x6d, 0x65, 0x73, 0x74, 0x61, 0x6d, 0x70, 0x2e, 0x70, 0x72, 0x6f, 0x74, - 0x6f, 0x12, 0x0f, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, - 0x75, 0x66, 0x22, 0x3b, 0x0a, 0x09, 0x54, 0x69, 0x6d, 0x65, 0x73, 0x74, 0x61, 0x6d, 0x70, 0x12, - 0x18, 0x0a, 0x07, 0x73, 0x65, 0x63, 0x6f, 0x6e, 0x64, 0x73, 0x18, 0x01, 0x20, 0x01, 0x28, 0x03, - 0x52, 0x07, 0x73, 0x65, 0x63, 0x6f, 0x6e, 0x64, 0x73, 0x12, 0x14, 0x0a, 0x05, 0x6e, 0x61, 0x6e, - 0x6f, 0x73, 0x18, 0x02, 0x20, 0x01, 0x28, 0x05, 0x52, 0x05, 0x6e, 0x61, 0x6e, 0x6f, 0x73, 0x42, - 0x85, 0x01, 0x0a, 0x13, 0x63, 0x6f, 0x6d, 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, - 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x42, 0x0e, 0x54, 0x69, 0x6d, 0x65, 0x73, 0x74, 0x61, - 0x6d, 0x70, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x50, 0x01, 0x5a, 0x32, 0x67, 0x6f, 0x6f, 0x67, 0x6c, - 0x65, 0x2e, 0x67, 0x6f, 0x6c, 0x61, 0x6e, 0x67, 0x2e, 0x6f, 0x72, 0x67, 0x2f, 0x70, 0x72, 0x6f, - 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2f, 0x74, 0x79, 0x70, 0x65, 0x73, 0x2f, 0x6b, 0x6e, 0x6f, 0x77, - 0x6e, 0x2f, 0x74, 0x69, 0x6d, 0x65, 0x73, 0x74, 0x61, 0x6d, 0x70, 0x70, 0x62, 0xf8, 0x01, 0x01, - 0xa2, 0x02, 0x03, 0x47, 0x50, 0x42, 0xaa, 0x02, 0x1e, 0x47, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, - 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, 0x57, 0x65, 0x6c, 0x6c, 0x4b, 0x6e, 0x6f, - 0x77, 0x6e, 0x54, 0x79, 0x70, 0x65, 0x73, 0x62, 0x06, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x33, -}) +const file_google_protobuf_timestamp_proto_rawDesc = "" + + "\n" + + "\x1fgoogle/protobuf/timestamp.proto\x12\x0fgoogle.protobuf\";\n" + + "\tTimestamp\x12\x18\n" + + "\aseconds\x18\x01 \x01(\x03R\aseconds\x12\x14\n" + + "\x05nanos\x18\x02 \x01(\x05R\x05nanosB\x85\x01\n" + + "\x13com.google.protobufB\x0eTimestampProtoP\x01Z2google.golang.org/protobuf/types/known/timestamppb\xf8\x01\x01\xa2\x02\x03GPB\xaa\x02\x1eGoogle.Protobuf.WellKnownTypesb\x06proto3" var ( file_google_protobuf_timestamp_proto_rawDescOnce sync.Once diff --git a/vendor/google.golang.org/protobuf/types/known/wrapperspb/wrappers.pb.go b/vendor/google.golang.org/protobuf/types/known/wrapperspb/wrappers.pb.go index 5de5301063b..b7c2d0607d7 100644 --- a/vendor/google.golang.org/protobuf/types/known/wrapperspb/wrappers.pb.go +++ b/vendor/google.golang.org/protobuf/types/known/wrapperspb/wrappers.pb.go @@ -28,10 +28,17 @@ // (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE // OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. // -// Wrappers for primitive (non-message) types. These types are useful -// for embedding primitives in the `google.protobuf.Any` type and for places -// where we need to distinguish between the absence of a primitive -// typed field and its default value. +// Wrappers for primitive (non-message) types. These types were needed +// for legacy reasons and are not recommended for use in new APIs. +// +// Historically these wrappers were useful to have presence on proto3 primitive +// fields, but proto3 syntax has been updated to support the `optional` keyword. +// Using that keyword is now the strongly preferred way to add presence to +// proto3 primitive fields. +// +// A secondary usecase was to embed primitives in the `google.protobuf.Any` +// type: it is now recommended that you embed your value in your own wrapper +// message which can be specifically documented. // // These wrappers have no meaningful use within repeated fields as they lack // the ability to detect presence on individual elements. @@ -54,6 +61,9 @@ import ( // Wrapper message for `double`. // // The JSON representation for `DoubleValue` is JSON number. +// +// Not recommended for use in new APIs, but still useful for legacy APIs and +// has no plan to be removed. type DoubleValue struct { state protoimpl.MessageState `protogen:"open.v1"` // The double value. @@ -107,6 +117,9 @@ func (x *DoubleValue) GetValue() float64 { // Wrapper message for `float`. // // The JSON representation for `FloatValue` is JSON number. +// +// Not recommended for use in new APIs, but still useful for legacy APIs and +// has no plan to be removed. type FloatValue struct { state protoimpl.MessageState `protogen:"open.v1"` // The float value. @@ -160,6 +173,9 @@ func (x *FloatValue) GetValue() float32 { // Wrapper message for `int64`. // // The JSON representation for `Int64Value` is JSON string. +// +// Not recommended for use in new APIs, but still useful for legacy APIs and +// has no plan to be removed. type Int64Value struct { state protoimpl.MessageState `protogen:"open.v1"` // The int64 value. @@ -213,6 +229,9 @@ func (x *Int64Value) GetValue() int64 { // Wrapper message for `uint64`. // // The JSON representation for `UInt64Value` is JSON string. +// +// Not recommended for use in new APIs, but still useful for legacy APIs and +// has no plan to be removed. type UInt64Value struct { state protoimpl.MessageState `protogen:"open.v1"` // The uint64 value. @@ -266,6 +285,9 @@ func (x *UInt64Value) GetValue() uint64 { // Wrapper message for `int32`. // // The JSON representation for `Int32Value` is JSON number. +// +// Not recommended for use in new APIs, but still useful for legacy APIs and +// has no plan to be removed. type Int32Value struct { state protoimpl.MessageState `protogen:"open.v1"` // The int32 value. @@ -319,6 +341,9 @@ func (x *Int32Value) GetValue() int32 { // Wrapper message for `uint32`. // // The JSON representation for `UInt32Value` is JSON number. +// +// Not recommended for use in new APIs, but still useful for legacy APIs and +// has no plan to be removed. type UInt32Value struct { state protoimpl.MessageState `protogen:"open.v1"` // The uint32 value. @@ -372,6 +397,9 @@ func (x *UInt32Value) GetValue() uint32 { // Wrapper message for `bool`. // // The JSON representation for `BoolValue` is JSON `true` and `false`. +// +// Not recommended for use in new APIs, but still useful for legacy APIs and +// has no plan to be removed. type BoolValue struct { state protoimpl.MessageState `protogen:"open.v1"` // The bool value. @@ -425,6 +453,9 @@ func (x *BoolValue) GetValue() bool { // Wrapper message for `string`. // // The JSON representation for `StringValue` is JSON string. +// +// Not recommended for use in new APIs, but still useful for legacy APIs and +// has no plan to be removed. type StringValue struct { state protoimpl.MessageState `protogen:"open.v1"` // The string value. @@ -478,6 +509,9 @@ func (x *StringValue) GetValue() string { // Wrapper message for `bytes`. // // The JSON representation for `BytesValue` is JSON string. +// +// Not recommended for use in new APIs, but still useful for legacy APIs and +// has no plan to be removed. type BytesValue struct { state protoimpl.MessageState `protogen:"open.v1"` // The bytes value. @@ -530,41 +564,32 @@ func (x *BytesValue) GetValue() []byte { var File_google_protobuf_wrappers_proto protoreflect.FileDescriptor -var file_google_protobuf_wrappers_proto_rawDesc = string([]byte{ - 0x0a, 0x1e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2f, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, - 0x66, 0x2f, 0x77, 0x72, 0x61, 0x70, 0x70, 0x65, 0x72, 0x73, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, - 0x12, 0x0f, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, - 0x66, 0x22, 0x23, 0x0a, 0x0b, 0x44, 0x6f, 0x75, 0x62, 0x6c, 0x65, 0x56, 0x61, 0x6c, 0x75, 0x65, - 0x12, 0x14, 0x0a, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x01, 0x52, - 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x22, 0x22, 0x0a, 0x0a, 0x46, 0x6c, 0x6f, 0x61, 0x74, 0x56, - 0x61, 0x6c, 0x75, 0x65, 0x12, 0x14, 0x0a, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x01, 0x20, - 0x01, 0x28, 0x02, 0x52, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x22, 0x22, 0x0a, 0x0a, 0x49, 0x6e, - 0x74, 0x36, 0x34, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x12, 0x14, 0x0a, 0x05, 0x76, 0x61, 0x6c, 0x75, - 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x03, 0x52, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x22, 0x23, - 0x0a, 0x0b, 0x55, 0x49, 0x6e, 0x74, 0x36, 0x34, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x12, 0x14, 0x0a, - 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x04, 0x52, 0x05, 0x76, 0x61, - 0x6c, 0x75, 0x65, 0x22, 0x22, 0x0a, 0x0a, 0x49, 0x6e, 0x74, 0x33, 0x32, 0x56, 0x61, 0x6c, 0x75, - 0x65, 0x12, 0x14, 0x0a, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x05, - 0x52, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x22, 0x23, 0x0a, 0x0b, 0x55, 0x49, 0x6e, 0x74, 0x33, - 0x32, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x12, 0x14, 0x0a, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, - 0x01, 0x20, 0x01, 0x28, 0x0d, 0x52, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x22, 0x21, 0x0a, 0x09, - 0x42, 0x6f, 0x6f, 0x6c, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x12, 0x14, 0x0a, 0x05, 0x76, 0x61, 0x6c, - 0x75, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x08, 0x52, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x22, - 0x23, 0x0a, 0x0b, 0x53, 0x74, 0x72, 0x69, 0x6e, 0x67, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x12, 0x14, - 0x0a, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, 0x09, 0x52, 0x05, 0x76, - 0x61, 0x6c, 0x75, 0x65, 0x22, 0x22, 0x0a, 0x0a, 0x42, 0x79, 0x74, 0x65, 0x73, 0x56, 0x61, 0x6c, - 0x75, 0x65, 0x12, 0x14, 0x0a, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x18, 0x01, 0x20, 0x01, 0x28, - 0x0c, 0x52, 0x05, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x42, 0x83, 0x01, 0x0a, 0x13, 0x63, 0x6f, 0x6d, - 0x2e, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, - 0x42, 0x0d, 0x57, 0x72, 0x61, 0x70, 0x70, 0x65, 0x72, 0x73, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x50, - 0x01, 0x5a, 0x31, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x67, 0x6f, 0x6c, 0x61, 0x6e, 0x67, - 0x2e, 0x6f, 0x72, 0x67, 0x2f, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2f, 0x74, 0x79, - 0x70, 0x65, 0x73, 0x2f, 0x6b, 0x6e, 0x6f, 0x77, 0x6e, 0x2f, 0x77, 0x72, 0x61, 0x70, 0x70, 0x65, - 0x72, 0x73, 0x70, 0x62, 0xf8, 0x01, 0x01, 0xa2, 0x02, 0x03, 0x47, 0x50, 0x42, 0xaa, 0x02, 0x1e, - 0x47, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x2e, 0x50, 0x72, 0x6f, 0x74, 0x6f, 0x62, 0x75, 0x66, 0x2e, - 0x57, 0x65, 0x6c, 0x6c, 0x4b, 0x6e, 0x6f, 0x77, 0x6e, 0x54, 0x79, 0x70, 0x65, 0x73, 0x62, 0x06, - 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x33, -}) +const file_google_protobuf_wrappers_proto_rawDesc = "" + + "\n" + + "\x1egoogle/protobuf/wrappers.proto\x12\x0fgoogle.protobuf\"#\n" + + "\vDoubleValue\x12\x14\n" + + "\x05value\x18\x01 \x01(\x01R\x05value\"\"\n" + + "\n" + + "FloatValue\x12\x14\n" + + "\x05value\x18\x01 \x01(\x02R\x05value\"\"\n" + + "\n" + + "Int64Value\x12\x14\n" + + "\x05value\x18\x01 \x01(\x03R\x05value\"#\n" + + "\vUInt64Value\x12\x14\n" + + "\x05value\x18\x01 \x01(\x04R\x05value\"\"\n" + + "\n" + + "Int32Value\x12\x14\n" + + "\x05value\x18\x01 \x01(\x05R\x05value\"#\n" + + "\vUInt32Value\x12\x14\n" + + "\x05value\x18\x01 \x01(\rR\x05value\"!\n" + + "\tBoolValue\x12\x14\n" + + "\x05value\x18\x01 \x01(\bR\x05value\"#\n" + + "\vStringValue\x12\x14\n" + + "\x05value\x18\x01 \x01(\tR\x05value\"\"\n" + + "\n" + + "BytesValue\x12\x14\n" + + "\x05value\x18\x01 \x01(\fR\x05valueB\x83\x01\n" + + "\x13com.google.protobufB\rWrappersProtoP\x01Z1google.golang.org/protobuf/types/known/wrapperspb\xf8\x01\x01\xa2\x02\x03GPB\xaa\x02\x1eGoogle.Protobuf.WellKnownTypesb\x06proto3" var ( file_google_protobuf_wrappers_proto_rawDescOnce sync.Once diff --git a/vendor/modules.txt b/vendor/modules.txt index 66b77f923fa..7969feb5018 100644 --- a/vendor/modules.txt +++ b/vendor/modules.txt @@ -417,7 +417,7 @@ github.com/go-openapi/spec # github.com/go-openapi/strfmt v0.23.0 ## explicit; go 1.20 github.com/go-openapi/strfmt -# github.com/go-openapi/swag v0.23.0 +# github.com/go-openapi/swag v0.23.1 ## explicit; go 1.20 github.com/go-openapi/swag # github.com/go-openapi/validate v0.24.0 @@ -433,7 +433,7 @@ github.com/go-redis/redis/v8/internal/pool github.com/go-redis/redis/v8/internal/proto github.com/go-redis/redis/v8/internal/rand github.com/go-redis/redis/v8/internal/util -# github.com/goccy/go-json v0.10.3 +# github.com/goccy/go-json v0.10.5 ## explicit; go 1.19 github.com/goccy/go-json github.com/goccy/go-json/internal/decoder @@ -464,7 +464,7 @@ github.com/gogo/status # github.com/golang-jwt/jwt/v5 v5.2.2 ## explicit; go 1.18 github.com/golang-jwt/jwt/v5 -# github.com/golang-migrate/migrate/v4 v4.18.1 +# github.com/golang-migrate/migrate/v4 v4.18.2 ## explicit; go 1.22.0 github.com/golang-migrate/migrate/v4 github.com/golang-migrate/migrate/v4/database @@ -485,7 +485,7 @@ github.com/golang/protobuf/ptypes/any github.com/golang/protobuf/ptypes/duration github.com/golang/protobuf/ptypes/empty github.com/golang/protobuf/ptypes/timestamp -# github.com/golang/snappy v0.0.4 +# github.com/golang/snappy v1.0.0 ## explicit github.com/golang/snappy # github.com/google/btree v1.1.2 @@ -556,13 +556,13 @@ github.com/grpc-ecosystem/go-grpc-middleware github.com/grpc-ecosystem/go-grpc-middleware/v2 github.com/grpc-ecosystem/go-grpc-middleware/v2/interceptors github.com/grpc-ecosystem/go-grpc-middleware/v2/interceptors/logging -# github.com/grpc-ecosystem/grpc-gateway/v2 v2.25.1 -## explicit; go 1.22.0 +# github.com/grpc-ecosystem/grpc-gateway/v2 v2.26.1 +## explicit; go 1.22 github.com/grpc-ecosystem/grpc-gateway/v2/internal/httprule github.com/grpc-ecosystem/grpc-gateway/v2/runtime github.com/grpc-ecosystem/grpc-gateway/v2/utilities -# github.com/hashicorp/consul/api v1.31.0 -## explicit; go 1.19 +# github.com/hashicorp/consul/api v1.32.0 +## explicit; go 1.22.12 github.com/hashicorp/consul/api # github.com/hashicorp/errwrap v1.1.0 ## explicit @@ -621,8 +621,8 @@ github.com/json-iterator/go # github.com/julienschmidt/httprouter v1.3.0 ## explicit; go 1.7 github.com/julienschmidt/httprouter -# github.com/klauspost/compress v1.17.11 -## explicit; go 1.21 +# github.com/klauspost/compress v1.18.0 +## explicit; go 1.22 github.com/klauspost/compress github.com/klauspost/compress/flate github.com/klauspost/compress/fse @@ -632,6 +632,7 @@ github.com/klauspost/compress/gzhttp/writer/gzkp github.com/klauspost/compress/gzip github.com/klauspost/compress/huff0 github.com/klauspost/compress/internal/cpuinfo +github.com/klauspost/compress/internal/le github.com/klauspost/compress/internal/race github.com/klauspost/compress/internal/snapref github.com/klauspost/compress/s2 @@ -639,8 +640,8 @@ github.com/klauspost/compress/snappy github.com/klauspost/compress/zlib github.com/klauspost/compress/zstd github.com/klauspost/compress/zstd/internal/xxhash -# github.com/klauspost/cpuid/v2 v2.2.8 -## explicit; go 1.15 +# github.com/klauspost/cpuid/v2 v2.2.10 +## explicit; go 1.22 github.com/klauspost/cpuid/v2 # github.com/kylelemons/godebug v1.1.0 ## explicit; go 1.11 @@ -657,8 +658,8 @@ github.com/lann/ps github.com/lib/pq github.com/lib/pq/oid github.com/lib/pq/scram -# github.com/mailru/easyjson v0.7.7 -## explicit; go 1.12 +# github.com/mailru/easyjson v0.9.0 +## explicit; go 1.20 github.com/mailru/easyjson/buffer github.com/mailru/easyjson/jlexer github.com/mailru/easyjson/jwriter @@ -683,11 +684,14 @@ github.com/metalmatze/signal/server/signalhttp # github.com/miekg/dns v1.1.63 ## explicit; go 1.19 github.com/miekg/dns +# github.com/minio/crc64nvme v1.0.1 +## explicit; go 1.22 +github.com/minio/crc64nvme # github.com/minio/md5-simd v1.1.2 ## explicit; go 1.14 github.com/minio/md5-simd -# github.com/minio/minio-go/v7 v7.0.82 -## explicit; go 1.22 +# github.com/minio/minio-go/v7 v7.0.90 +## explicit; go 1.23.0 github.com/minio/minio-go/v7 github.com/minio/minio-go/v7/pkg/cors github.com/minio/minio-go/v7/pkg/credentials @@ -751,8 +755,8 @@ github.com/open-telemetry/opentelemetry-collector-contrib/processor/deltatocumul github.com/open-telemetry/opentelemetry-collector-contrib/processor/deltatocumulativeprocessor/internal/metrics github.com/open-telemetry/opentelemetry-collector-contrib/processor/deltatocumulativeprocessor/internal/putil/pslice github.com/open-telemetry/opentelemetry-collector-contrib/processor/deltatocumulativeprocessor/internal/telemetry -# github.com/opentracing-contrib/go-grpc v0.1.0 -## explicit; go 1.22.7 +# github.com/opentracing-contrib/go-grpc v0.1.2 +## explicit; go 1.23.8 github.com/opentracing-contrib/go-grpc # github.com/opentracing-contrib/go-stdlib v1.1.0 ## explicit; go 1.14 @@ -832,8 +836,8 @@ github.com/prometheus/alertmanager/template github.com/prometheus/alertmanager/timeinterval github.com/prometheus/alertmanager/types github.com/prometheus/alertmanager/ui -# github.com/prometheus/client_golang v1.21.1 -## explicit; go 1.21 +# github.com/prometheus/client_golang v1.22.0 +## explicit; go 1.22 github.com/prometheus/client_golang/api github.com/prometheus/client_golang/api/prometheus/v1 github.com/prometheus/client_golang/internal/github.com/golang/gddo/httputil @@ -844,14 +848,15 @@ github.com/prometheus/client_golang/prometheus/collectors/version github.com/prometheus/client_golang/prometheus/internal github.com/prometheus/client_golang/prometheus/promauto github.com/prometheus/client_golang/prometheus/promhttp +github.com/prometheus/client_golang/prometheus/promhttp/internal github.com/prometheus/client_golang/prometheus/push github.com/prometheus/client_golang/prometheus/testutil github.com/prometheus/client_golang/prometheus/testutil/promlint github.com/prometheus/client_golang/prometheus/testutil/promlint/validations -# github.com/prometheus/client_model v0.6.1 -## explicit; go 1.19 +# github.com/prometheus/client_model v0.6.2 +## explicit; go 1.22.0 github.com/prometheus/client_model/go -# github.com/prometheus/common v0.62.0 +# github.com/prometheus/common v0.63.0 ## explicit; go 1.21 github.com/prometheus/common/config github.com/prometheus/common/expfmt @@ -863,8 +868,8 @@ github.com/prometheus/common/version # github.com/prometheus/exporter-toolkit v0.13.2 ## explicit; go 1.22 github.com/prometheus/exporter-toolkit/web -# github.com/prometheus/procfs v0.15.1 -## explicit; go 1.20 +# github.com/prometheus/procfs v0.16.1 +## explicit; go 1.23.0 github.com/prometheus/procfs github.com/prometheus/procfs/internal/fs github.com/prometheus/procfs/internal/util @@ -972,8 +977,8 @@ github.com/soheilhy/cmux # github.com/sony/gobreaker v1.0.0 ## explicit; go 1.12 github.com/sony/gobreaker -# github.com/spf13/afero v1.11.0 -## explicit; go 1.19 +# github.com/spf13/afero v1.14.0 +## explicit; go 1.23.0 github.com/spf13/afero github.com/spf13/afero/internal/common github.com/spf13/afero/mem @@ -1079,7 +1084,7 @@ github.com/thanos-io/thanos/pkg/tracing/interceptors github.com/thanos-io/thanos/pkg/tracing/migration github.com/thanos-io/thanos/pkg/tracing/tracing_middleware github.com/thanos-io/thanos/pkg/tracing/util/metautils -# github.com/tjhop/slog-gokit v0.1.3 +# github.com/tjhop/slog-gokit v0.1.4 ## explicit; go 1.21 github.com/tjhop/slog-gokit # github.com/trivago/tgo v1.0.7 @@ -1143,24 +1148,24 @@ github.com/yuin/gopher-lua/pm # github.com/zhangyunhao116/umap v0.0.0-20221211160557-cb7705fafa39 ## explicit; go 1.13 github.com/zhangyunhao116/umap -# go.etcd.io/etcd/api/v3 v3.5.17 -## explicit; go 1.22 +# go.etcd.io/etcd/api/v3 v3.5.21 +## explicit; go 1.23.0 go.etcd.io/etcd/api/v3/authpb go.etcd.io/etcd/api/v3/etcdserverpb go.etcd.io/etcd/api/v3/membershippb go.etcd.io/etcd/api/v3/mvccpb go.etcd.io/etcd/api/v3/v3rpc/rpctypes go.etcd.io/etcd/api/v3/version -# go.etcd.io/etcd/client/pkg/v3 v3.5.17 -## explicit; go 1.22 +# go.etcd.io/etcd/client/pkg/v3 v3.5.21 +## explicit; go 1.23.0 go.etcd.io/etcd/client/pkg/v3/fileutil go.etcd.io/etcd/client/pkg/v3/logutil go.etcd.io/etcd/client/pkg/v3/systemd go.etcd.io/etcd/client/pkg/v3/tlsutil go.etcd.io/etcd/client/pkg/v3/transport go.etcd.io/etcd/client/pkg/v3/types -# go.etcd.io/etcd/client/v3 v3.5.17 -## explicit; go 1.22 +# go.etcd.io/etcd/client/v3 v3.5.21 +## explicit; go 1.23.0 go.etcd.io/etcd/client/v3 go.etcd.io/etcd/client/v3/credentials go.etcd.io/etcd/client/v3/internal/endpoint @@ -1206,8 +1211,8 @@ go.opentelemetry.io/collector/config/configtelemetry ## explicit; go 1.22.0 go.opentelemetry.io/collector/consumer go.opentelemetry.io/collector/consumer/internal -# go.opentelemetry.io/collector/pdata v1.24.0 -## explicit; go 1.22.0 +# go.opentelemetry.io/collector/pdata v1.30.0 +## explicit; go 1.23.0 go.opentelemetry.io/collector/pdata/internal go.opentelemetry.io/collector/pdata/internal/data go.opentelemetry.io/collector/pdata/internal/data/protogen/collector/logs/v1 @@ -1254,7 +1259,7 @@ go.opentelemetry.io/contrib/instrumentation/net/http/otelhttp/internal/semconvut # go.opentelemetry.io/contrib/propagators/autoprop v0.54.0 ## explicit; go 1.21 go.opentelemetry.io/contrib/propagators/autoprop -# go.opentelemetry.io/contrib/propagators/aws v1.33.0 +# go.opentelemetry.io/contrib/propagators/aws v1.35.0 ## explicit; go 1.22.0 go.opentelemetry.io/contrib/propagators/aws/xray # go.opentelemetry.io/contrib/propagators/b3 v1.29.0 @@ -1283,15 +1288,15 @@ go.opentelemetry.io/otel/semconv/v1.17.0/httpconv go.opentelemetry.io/otel/semconv/v1.20.0 go.opentelemetry.io/otel/semconv/v1.21.0 go.opentelemetry.io/otel/semconv/v1.26.0 -# go.opentelemetry.io/otel/bridge/opentracing v1.33.0 +# go.opentelemetry.io/otel/bridge/opentracing v1.35.0 ## explicit; go 1.22.0 go.opentelemetry.io/otel/bridge/opentracing go.opentelemetry.io/otel/bridge/opentracing/migration -# go.opentelemetry.io/otel/exporters/otlp/otlptrace v1.34.0 +# go.opentelemetry.io/otel/exporters/otlp/otlptrace v1.35.0 ## explicit; go 1.22.0 go.opentelemetry.io/otel/exporters/otlp/otlptrace go.opentelemetry.io/otel/exporters/otlp/otlptrace/internal/tracetransform -# go.opentelemetry.io/otel/exporters/otlp/otlptrace/otlptracegrpc v1.34.0 +# go.opentelemetry.io/otel/exporters/otlp/otlptrace/otlptracegrpc v1.35.0 ## explicit; go 1.22.0 go.opentelemetry.io/otel/exporters/otlp/otlptrace/otlptracegrpc go.opentelemetry.io/otel/exporters/otlp/otlptrace/otlptracegrpc/internal @@ -1358,7 +1363,7 @@ go4.org/intern # go4.org/unsafe/assume-no-moving-gc v0.0.0-20230525183740-e7c30c78aeb2 ## explicit; go 1.11 go4.org/unsafe/assume-no-moving-gc -# golang.org/x/crypto v0.36.0 +# golang.org/x/crypto v0.37.0 ## explicit; go 1.23.0 golang.org/x/crypto/argon2 golang.org/x/crypto/bcrypt @@ -1373,14 +1378,14 @@ golang.org/x/crypto/internal/alias golang.org/x/crypto/internal/poly1305 golang.org/x/crypto/pkcs12 golang.org/x/crypto/pkcs12/internal/rc2 -# golang.org/x/exp v0.0.0-20240613232115-7f521ea00fb8 -## explicit; go 1.20 +# golang.org/x/exp v0.0.0-20250106191152-7588d65b2ba8 +## explicit; go 1.22.0 golang.org/x/exp/constraints golang.org/x/exp/slices # golang.org/x/mod v0.24.0 ## explicit; go 1.23.0 golang.org/x/mod/semver -# golang.org/x/net v0.38.0 +# golang.org/x/net v0.39.0 ## explicit; go 1.23.0 golang.org/x/net/bpf golang.org/x/net/context @@ -1399,7 +1404,7 @@ golang.org/x/net/ipv6 golang.org/x/net/netutil golang.org/x/net/publicsuffix golang.org/x/net/trace -# golang.org/x/oauth2 v0.25.0 +# golang.org/x/oauth2 v0.26.0 ## explicit; go 1.18 golang.org/x/oauth2 golang.org/x/oauth2/authhandler @@ -1412,18 +1417,18 @@ golang.org/x/oauth2/google/internal/stsexchange golang.org/x/oauth2/internal golang.org/x/oauth2/jws golang.org/x/oauth2/jwt -# golang.org/x/sync v0.12.0 +# golang.org/x/sync v0.13.0 ## explicit; go 1.23.0 golang.org/x/sync/errgroup golang.org/x/sync/semaphore golang.org/x/sync/singleflight -# golang.org/x/sys v0.31.0 +# golang.org/x/sys v0.32.0 ## explicit; go 1.23.0 golang.org/x/sys/cpu golang.org/x/sys/unix golang.org/x/sys/windows golang.org/x/sys/windows/registry -# golang.org/x/text v0.23.0 +# golang.org/x/text v0.24.0 ## explicit; go 1.23.0 golang.org/x/text/cases golang.org/x/text/internal @@ -1436,8 +1441,8 @@ golang.org/x/text/secure/bidirule golang.org/x/text/transform golang.org/x/text/unicode/bidi golang.org/x/text/unicode/norm -# golang.org/x/time v0.9.0 -## explicit; go 1.18 +# golang.org/x/time v0.11.0 +## explicit; go 1.23.0 golang.org/x/time/rate # golang.org/x/tools v0.31.0 ## explicit; go 1.23.0 @@ -1498,17 +1503,17 @@ google.golang.org/api/transport/http ## explicit; go 1.21 google.golang.org/genproto/googleapis/type/date google.golang.org/genproto/googleapis/type/expr -# google.golang.org/genproto/googleapis/api v0.0.0-20250115164207-1a7da9e5054f +# google.golang.org/genproto/googleapis/api v0.0.0-20250218202821-56aae31c358a ## explicit; go 1.22 google.golang.org/genproto/googleapis/api google.golang.org/genproto/googleapis/api/annotations google.golang.org/genproto/googleapis/api/httpbody -# google.golang.org/genproto/googleapis/rpc v0.0.0-20250115164207-1a7da9e5054f +# google.golang.org/genproto/googleapis/rpc v0.0.0-20250218202821-56aae31c358a ## explicit; go 1.22 google.golang.org/genproto/googleapis/rpc/code google.golang.org/genproto/googleapis/rpc/errdetails google.golang.org/genproto/googleapis/rpc/status -# google.golang.org/grpc v1.70.0 => google.golang.org/grpc v1.65.0 +# google.golang.org/grpc v1.71.1 => google.golang.org/grpc v1.65.0 ## explicit; go 1.21 google.golang.org/grpc google.golang.org/grpc/attributes @@ -1578,8 +1583,8 @@ google.golang.org/grpc/stats google.golang.org/grpc/status google.golang.org/grpc/tap google.golang.org/grpc/test/bufconn -# google.golang.org/protobuf v1.36.4 -## explicit; go 1.21 +# google.golang.org/protobuf v1.36.6 +## explicit; go 1.22 google.golang.org/protobuf/encoding/protodelim google.golang.org/protobuf/encoding/protojson google.golang.org/protobuf/encoding/prototext